KEGG   Pseudomonas avellanae: BKM03_02100
Entry
BKM03_02100       CDS       T05369                                 

Definition
(GenBank) preprotein translocase subunit Tim44
  KO
K03397  indoleacetate---lysine synthetase [EC:6.3.2.20]
Organism
pavl  Pseudomonas avellanae
Brite
KEGG Orthology (KO) [BR:pavl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKM03_02100
Enzymes [BR:pavl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.20  indoleacetate---lysine synthetase
     BKM03_02100
SSDB
Motif
Pfam: AMP-binding
Other DBs
NCBI-ProteinID: AVB18205
UniProt: A0A6H3CZJ4
LinkDB
Position
408109..409296
AA seq 395 aa
MTAYDVEKEWSRISNTAAKTHQNNDFEGFTYQDFRKHVPIMDKEGFAAQTERCLERNERN
CLIGFTSGTSGNLKRCYYYYDCEVDEDSSRSNVFRSNGFIQPGDRCANLFTINLFSALNN
ITTMMAGNCGAHVVSVGDITLLTKSHFEALNSIKLNVLLGVPSTILQFIDAMQQHGVHID
IEKVVFNGEGLKTFQKKIIREAFGEQVSIVGVYGSSEGGILGFTDSPCHTEYEFLSNKYF
IEKEGDSILITSLTRENFTPLLRYRLGDTATLSLKGDKLYLTDIQREDMSFNFMGNLIGL
GIIQQAIKQTLGRTLEIQVHLSVTDERKELVTVFVQASEVDEDERTRIETAIADIPDINE
AYQKDQGSVRVLRKDARDYAVSERGKMLYIIDRRN
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgactgcctacgatgtagaaaaggaatggagcagaatttccaatactgccgctaaaact
caccagaacaacgattttgaaggtttcacctaccaggacttcagaaaacacgtaccgata
atggacaaggaaggcttcgcggcacagaccgaacgctgccttgagcgcaacgagcgaaac
tgcctgatcggctttaccagtggcaccagcggcaacctcaagcgctgttattactactac
gactgtgaggtcgatgaagacagctcccgctccaacgtctttcgcagcaacggtttcatt
cagcccggtgatcgctgcgccaacctcttcaccatcaacctgttttctgccctgaacaac
atcaccaccatgatggccggtaactgcggtgcgcatgtcgtgtcggtgggcgatatcacc
ctgctgaccaagagtcacttcgaggcactcaactcgatcaagctcaacgtactgctcggc
gtaccctcgaccatcctgcagttcatcgacgccatgcaacagcacggtgtgcacatcgat
atcgaaaaggtcgtcttcaatggcgaaggcctgaaaaccttccagaagaaaatcatcagg
gaagccttcggcgaacaagtctccatcgtcggtgtgtatggcagttccgagggcggcatt
cttggcttcaccgacagcccttgccacaccgaatacgagtttctgtccaacaagtacttc
attgaaaaagaaggcgacagcatcctcatcacctcgctgacccgcgagaacttcacgccg
ctgctccggtatcgtctgggagacaccgcaacgctttcgctgaaaggcgacaagctttat
ctgactgatatccagcgggaggacatgagcttcaacttcatgggcaacctcattggtctg
ggcatcatccagcaagcgatcaaacagacactgggccgcacgctggaaattcaggttcac
ttgtcagtgaccgacgagcgtaaggaactggtgactgttttcgttcaagcctcggaagtt
gacgaagacgaacgcacccgaatcgaaacagccatcgccgatattccggacatcaacgag
gcctatcagaaagaccagggcagtgtgcgggttctgcgcaaggatgccagagactacgcc
gtctcggagcgaggcaaaatgctctacatcattgaccgccgaaactga

DBGET integrated database retrieval system