KEGG   Pseudomonas avellanae: BKM03_11910Help
Entry
BKM03_11910       CDS       T05369                                 

Gene name
ligD
Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pavl  Pseudomonas avellanae
Pathway
pavl03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pavl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    BKM03_11910 (ligD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pavl03400]
    BKM03_11910 (ligD)
Enzymes [BR:pavl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     BKM03_11910 (ligD)
DNA repair and recombination proteins [BR:pavl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     BKM03_11910 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AVB19868
UniProt: A0A2S3TI54
LinkDB All DBs
Position
2392437..2394992
Genome map
AA seq 851 aa AA seqDB search
MAKPASEYTRKRNFDVTSEPAESKRKGKARSGALSFVIQKHDARNLHYDFRLELDGTLKS
WAVPKGPSLDPKQKRLAVHVEDHPLDYAAFEGSIPKGQYGGGDVIVWDRGIWQPHGDPHE
TYADGKLKFTLIGEKLSGEWALVRTRLKGSGSKEQWLLIKEKDDIARPAAEYDITEAQPQ
SVISGAHIGAGRSAPAKSKAKAVEAKPARKPAPKKANVVFPDTLAPQLATLVDAPPAGDW
LYEIKFDGYRMLTRIQNDEVRLFTRNGNDWTDQLPELTKALKGLKLQDSWFDGEVVVLDE
QGLPDFQGLQNAFDVGHSKNIFYYLFDMPFLSGEDLREVPLEQRRDALKQVLGSQRSRLL
RYSDAFQAGHQDIVASAAAMGLEGVIGKRAGSAYVGKRNADWIKLKCRLRQEFVIVGYTA
PQGSRSAFGALLLAVNDDAQGLVYAGRVGTGFTEATLKYVHKQLKPLHREESPLANKLTS
AQARGVQWVEPTLVCEAEFAQWTREGIVRQAAFFGLRSDKPATDVVREEAQPAKAASVTP
EPSRQPGKKTARGKVDVAGTGISHPQRVIDSKTGTKKIELAQFYESIADWVLPFLDKRPV
ALLRCPEGIDGEQFFQKHAEHLAIPHIRQLDRALDPGHAALMEIDSVQALVGAAQMGAIE
LHTWGATRDRIETPDHFVLDLDPDPALPWRSMIEATQMVLAVLEELGLEAFLKTSGGKGM
HIIVPLARQAEWDTVKAFAKAIAEFISRQLPERFTATMGPKNRVGKIFIDYLRNSRGGST
VTAYSVRARPGLPVSVPIALHELTGLTSSAQWDITNLEQRLSQLKDDPWAGYSNRRKITQ
KMWKQLGAKRP
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggccaagcccgccagcgaatacacgcgcaagcgcaacttcgacgtcacctccgagcct
gcagagagcaagcgtaaaggcaaagcgcggtccggtgcactgagctttgtgattcagaag
cacgatgcgcgcaacctgcattacgactttcggctggaactggacggtacgctgaagagc
tgggcggtgcccaaagggcccagcctggacccgaagcagaagcgtctggccgtgcatgtc
gaagatcacccgctggactacgcggcttttgaaggcagcattccgaaaggccagtacggc
ggaggcgatgtgatcgtctgggacaggggcatctggcaaccccatggtgatccacacgag
acctatgcggacggcaaactcaagttcaccctgatcggcgaaaaactcagtggcgagtgg
gcgctggtgcgcacccggctcaagggcagcggcagcaaagagcaatggctgctgatcaag
gaaaaggacgacattgcgcggcctgccgccgaatacgacatcaccgaggcgcaaccgcaa
agcgtgatcagtggggcgcacatcggggcagggcgttcagcgccagcaaagtccaaagcc
aaggccgttgaagcgaagcctgcgcgcaagcccgcgccgaaaaaggcgaacgtcgttttc
ccggacacgcttgcgccgcaactggcgacactggtcgatgcgccgcctgcgggcgactgg
ctgtacgagatcaagtttgacggctatcgcatgctgacgcgtatccagaacgatgaggtg
cgcctgttcacccgtaacggcaacgactggaccgatcagttgcccgagctgaccaaggcg
ctcaagggcttgaagttgcaggacagttggttcgacggcgaagtggtggtgctcgacgaa
caagggctgccggattttcaggggctgcagaatgcctttgatgtggggcacagcaaaaac
attttctattacctgttcgacatgccgtttctgagcggcgaagacctgcgcgaagtgcca
cttgagcagcgtcgcgacgctttgaaacaagttctcggcagccagcgcagccgcttgttg
cgctactcggatgcgtttcaggccgggcatcaggacattgtggccagtgctgccgcgatg
ggcctggagggcgtaatcggcaagcgcgctggcagcgcgtacgtcggcaagcgcaatgcc
gactggatcaagctcaaatgccggttgcgccaggaattcgtgatcgtcggctataccgcg
ccgcaaggcagccgctcggccttcggcgcgctgttgctggcggtcaatgacgatgcccaa
gggctggtgtatgccggacgggtcggcaccgggtttaccgaggcgacgctcaaatacgtg
cacaagcagctgaaaccgctgcaccgcgaggaatcgcccttggcgaataaactgacctcg
gcgcaggcgcgcggggtgcagtgggtcgagccgacgctggtttgcgaagctgaatttgcg
cagtggactcgcgagggcatcgtgcgtcaggcagcttttttcggcctgcgcagtgacaag
ccagctaccgatgtggtgcgtgaagaggctcagccagccaaggctgcgtcagtcactcct
gagccctccaggcagcccggcaagaaaactgcccgaggcaaggtcgatgtggcgggcact
ggcatcagtcatccgcagcgggtgatcgacagcaagaccggcacgaagaaaatcgagctt
gcgcagttttacgagtcgattgccgactgggttctgccgttcctggacaagcggccagtg
gcgttgctgcgctgtccggaaggcatcgacggtgagcagtttttccagaaacacgccgag
cacctcgccataccgcatatcaggcaactggatcgcgcgctggaccccggccacgccgcg
ctgatggagatcgactctgtgcaggcgctggtgggcgcggcgcagatgggcgctatcgag
ttgcacacctggggcgcgacccgcgacaggatcgaaacgccggatcattttgtgctggac
cttgatccagacccggcgctgccttggcgcagcatgattgaggccacgcaaatggttctc
gccgtactagaggagctggggcttgaagcttttctcaagaccagtggcggcaaaggcatg
cacattattgtgccgctggcgcgacaggctgagtgggacaccgtgaaagctttcgccaag
gccatcgccgagttcatcagccgtcagttgccggaacgcttcactgcaaccatgggaccg
aaaaaccgggtcggcaagattttcatcgattacctgcgcaacagtcgcggcggcagcaca
gtgactgcctattcggtacgcgcccggccgggtttgccggtctcggtgccgattgcgctg
catgagttgaccggcctgacatcgtcggcacaatgggacatcaccaaccttgagcaacgc
ttgagccagctcaaggatgatccatgggccggttacagcaaccggcgcaaaatcacgcaa
aaaatgtggaaacagctgggggctaaacggccttga

DBGET integrated database retrieval system