KEGG   Pseudomonas avellanae: BKM03_13570Help
Entry
BKM03_13570       CDS       T05369                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pavl  Pseudomonas avellanae
Brite
KEGG Orthology (KO) [BR:pavl00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKM03_13570
Enzymes [BR:pavl01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BKM03_13570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 DAO HI0933_like FAD_oxidored AlaDh_PNT_C Glutaredoxin Thi4 K_oxygenase FAD_binding_3 NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AVB20135
UniProt: A0A2S3TE17
LinkDB All DBs
Position
2755802..2757364
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTRPIEIVASLDDGAKSQEMLALLNDVISVSKDVTLNDSGTDAR
TPSFSLSSPGHDISLRFAGIPMGHEFTSLVLALLQVGGYPPKVSAETIEQVRALQGEFHF
ETYFSQSCQNCPDVVQALNLMAVLNPGIKHVAIDGALFQDEVTERKIMSVPSIYLNGELF
GQGRMGLEEILAKIDTGAGARQAEKLNAKQSFDVLVVGGGPAGSAAAVYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQHTEGPKLAVALEEHVKQYEVDIMNLQRADKLIPGKAGEL
HEVKFASGASLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVSHVTLLEFDVQLRADAVLQRKLHSLPNVTVLTSAQTTEVTGDEQ
KVNGLRYKNRTTGEEITIPLEGIFVQIGLLPNSEWLKGALELSPRGEIVVDARGETSVPG
IFAAGDVTVTPYKQIIIALGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagcccagttgaaatcctacctggagcgggtcactcgcccc
atcgagatcgtcgcgtcccttgatgacggcgcgaagtctcaggaaatgcttgcactgctc
aacgatgtgatcagtgtttccaaagacgtcaccctgaacgacagcggcaccgacgcacgt
acgccgtcgttctcgctgagcagccctggccacgatatcagcctgcgtttcgccggtatc
cccatgggccacgaattcacctcgctggttttggcgttgctgcaagttggcggctaccca
cccaaggtcagtgcggaaaccatcgaacaggttcgcgctctgcaaggcgagttccatttc
gaaacctatttctcgcagtcctgccagaactgcccggacgtcgtccaggcgttgaacctg
atggcagtactgaaccctggcatcaagcacgtcgccattgacggcgcgctgttccaggac
gaagtcaccgaacgcaagatcatgtcggtgccgagcatctacctgaacggcgagctgttc
ggtcagggccgtatgggtctggaagaaattctcgccaagatcgacaccggtgccggtgcg
cgtcaggccgagaagctcaacgccaagcagtcctttgatgtgctggtggtgggtggcggt
cctgccggttcggcggctgcggtctatgccgcccgcaaaggcatccgcaccggcgttgca
gccgagcgtttcggcggtcaggtgctcgacaccatggccatcgaaaacttcatctcggta
caacacaccgaagggccgaagctggctgttgcgctcgaagagcacgtcaagcagtacgaa
gtcgacatcatgaacctgcaacgcgccgacaagctgattccgggcaaggccggtgagctg
cacgaagtgaagttcgccagcggcgcaagcctcaaggccaagacggtcatccttgctact
ggcgcgcgctggagggagatgaacgttcccggtgagcagcaataccgcaacaagggtgtg
gcctactgcccgcactgcgacggtccgctgttcaaaggcaagcgcgttgccgtgattggt
ggcggtaactcgggcgtcgaagcggcaatcgacctggcgggtatcgtgtctcacgtcacg
ctgctggaattcgacgtgcaactgcgcgccgatgcagtgctgcaacgcaagctgcacagc
ctgccgaacgtcaccgtgcttaccagtgcgcaaaccactgaagtgactggcgacgagcag
aaggtcaatggcctgcgttacaagaaccgcacgactggcgaagaaatcaccattcctctg
gaaggtatttttgtgcagatcggcctgctgcccaacagcgaatggctcaaaggcgccctt
gagttgtcgccgcgtggcgagatcgtggtggatgcgcggggtgaaacgtcagtgccgggc
atcttcgctgccggtgacgtgaccgtgacgccgtacaagcagatcatcatcgccctgggc
gagggtgccaaggcctcgctgagcgcttttgatcacctgatccgtacctccgcgccagcc
tga

DBGET integrated database retrieval system