KEGG   Cutibacterium acnes 266: PAZ_c07300Help
Entry
PAZ_c07300        CDS       T01971                                 

Gene name
nanA
Definition
(GenBank) sialidase A
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00511  Other glycan degradation
paw00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:paw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    PAZ_c07300 (nanA)
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PAZ_c07300 (nanA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:paw02042]
    PAZ_c07300 (nanA)
Enzymes [BR:paw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     PAZ_c07300 (nanA)
Bacterial toxins [BR:paw02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   PAZ_c07300 (nanA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 Laminin_G_3 Laminin_G_2 BNR_3 BNR Laminin_G_1 PSII_BNR
Motif
Other DBs
NCBI-ProteinID: AEE71914
LinkDB All DBs
Position
complement(743525..745840)
Genome map
AA seq 771 aa AA seqDB search
MTITDTYTEELAIDLTGSALLPARKGMDVQRIDGEDGSLLVEFSATSSGCLFELVGKNGR
LSVDVDEDRLLGRIDLNGESRSLDAEDALGMADGTIHSVGLTADETGTHLFADGYETFSA
TLRVWCQDLGATNIVINPSGVLDVRRFKMWNSALSLQAMAAKAPTATPFVEFAGSELSAR
DARRIGELAHGALRARTRLRGKGQGGTVLAAQGSAGELSFEIVNGDLLLHVEVDDEPIAH
VRAPGKWDDGNWHDLVAISGRGAIDLYVDGFLVAHEPGEAFFADLGKVERVTVGKDLEGA
RLFGEAQTASIFSSALTDAQVKRLANVAPLRTQALFDTGYLGSKSYRIPSLIRLDSGSFI
AGADQRVSIANDSPNDINFVIRRSEDGRRWDEAQIVLEYPGEGALGASVIDSVLFQDHNS
GRVFCLIDQFPGGVGQPNAEPGSGFDEQGRQLLFDRDATAYVIDAEGIVTTESGEPTDYT
VDETGNVFAAGAPAGNIHLATGVDPHESLLTLRTCNLILIHSDDDGRTWSRPINLNPALK
QPWMRFLGTSPGNGIQLEHGTHRGRLLAPVYYNHEEGKTFSCAAVYSDDGGQTWNLGKSP
NDERELFGKIVSSRNLNDDRGSTHESALVETPDGVVHSFMRNQHPSGRVAHAASVDGGET
WGEVTFVEQLTEIFSQPNAISVRDELGTESVVFANASMMLPFRGCGVLRQSFDGGKTWPH
NRVLNPRHHVYQCMTQQDEQTLLVLWEREWQGLFLTEVPLSWLTTSRSTLE
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atgactattactgatacttataccgaggaattggcgattgaccttactgggagcgccttg
ctgccggcccgaaagggcatggacgtgcaacgaatcgacggcgaggacggctcacttctc
gtggaattcagcgcgacgtcctccggatgcctgttcgagcttgtcggaaagaacggacgg
ttatcagtcgatgtggatgaagaccgcttgcttggccgtatagatctgaacggagaatct
cgcagtctcgacgccgaggatgcgctgggcatggcagatggcacgattcactccgtcgga
ctcaccgccgatgaaactgggacgcatttgtttgcagacggttacgaaacattctccgcc
acattgcgggtatggtgccaggatctgggagcaaccaatattgtcatcaatccgtcgggc
gtcctcgacgtacggcgattcaagatgtggaactcagccctgtccttgcaagctatggcg
gccaaggcgccgacggcaacaccgttcgtcgagttcgctggttctgagctgtcggcccgc
gacgcacgccgtatcggagaactcgctcatggcgcgctccgagcaaggacccgccttcgt
ggcaaaggccagggtggaaccgtcctcgcagcccaagggagcgccggtgaactgtccttc
gagatcgtcaacggcgacctgctcctgcacgtggaagtggacgatgaacccatcgcccac
gtgcgcgctccaggcaagtgggacgacggaaactggcatgacctggtagcaatcagtggc
cggggtgccattgatctctatgttgacggtttcctcgtggctcacgagcctggtgaggca
ttctttgccgatcttggcaaggtggaaagggtgaccgtcgggaaggacctcgaaggagca
cggctattcggggaagcgcagacggcgtccatcttcagcagtgcgctaaccgacgcccaa
gtcaaacgcctagccaacgtggctcctctacgtacccaagctctcttcgacacgggatat
ctgggctcgaaaagttaccggatcccatcgctcatcagacttgattccggaagcttcatc
gccggggcagaccaacgtgtcagcattgccaacgacagccccaacgacatcaatttcgtc
atccgtcgcagcgaagacggtcgtcggtgggacgaggcccagatagtcctcgagtatccc
ggcgagggcgccctcggagcatcggttatcgactcagttctgttccaagaccacaactcg
gggcgcgtgttctgcttgatcgaccagttcccgggtggcgtggggcagcctaacgccgaa
ccagggtcgggcttcgatgagcaaggtcggcagcttctgttcgatcgcgatgcaaccgcc
tacgtcatcgatgcagaaggcatcgtaacaaccgagtcgggggaacccacggactacacc
gttgacgaaaccggaaacgtcttcgcagccggtgcccccgccggcaatatccacttggcc
accggagtggacccccacgagtccctgctgaccctacggacctgcaacctcatcctcatc
cacagtgatgacgacggacggacatggtcacgacctatcaacctgaacccggctctcaag
cagccttggatgcggttcctcggtacgtcaccgggcaacggaattcagttggaacacggg
acgcaccgaggccgactcctggcaccggtctactacaaccacgaggagggaaaaaccttt
tcatgtgccgcggtgtacagcgatgacgggggccagacatggaacctcggtaagtcaccg
aatgacgagcgcgaacttttcggaaagatcgtcagttctcgaaatctcaacgatgatcgc
ggctcgacccatgagtcagcgttagtagaaacccctgacggggtcgtgcactccttcatg
cgcaaccaacatccctccggacgggtggcgcacgcggccagcgtcgacggcggcgaaaca
tggggcgaggtgacgttcgtcgagcaactgaccgaaatcttctcccagcccaatgccatt
tctgtccgggatgagcttggaaccgaatcggtggtctttgccaatgcgtcgatgatgctc
ccgttccggggttgtggtgtgctgcgtcaaagtttcgacggaggcaagacctggccgcac
aaccgcgtgctcaaccctcgccatcatgtgtaccaatgcatgactcagcaagacgaacag
accctgctcgtattgtgggaacgggagtggcaaggcttgttcctgacagaggtcccgttg
tcatggcttaccacttcgcgcagcacgctggagtga

DBGET integrated database retrieval system