KEGG   Cutibacterium acnes 266: PAZ_c23600Help
Entry
PAZ_c23600        CDS       T01971                                 

Gene name
pfkA2
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00010  Glycolysis / Gluconeogenesis
paw00030  Pentose phosphate pathway
paw00051  Fructose and mannose metabolism
paw00052  Galactose metabolism
paw00680  Methane metabolism
paw01100  Metabolic pathways
paw01110  Biosynthesis of secondary metabolites
paw01120  Microbial metabolism in diverse environments
paw01130  Biosynthesis of antibiotics
paw01200  Carbon metabolism
paw01230  Biosynthesis of amino acids
paw03018  RNA degradation
Module
paw_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:paw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PAZ_c23600 (pfkA2)
   00030 Pentose phosphate pathway
    PAZ_c23600 (pfkA2)
   00051 Fructose and mannose metabolism
    PAZ_c23600 (pfkA2)
   00052 Galactose metabolism
    PAZ_c23600 (pfkA2)
  09102 Energy metabolism
   00680 Methane metabolism
    PAZ_c23600 (pfkA2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    PAZ_c23600 (pfkA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:paw01009]
    PAZ_c23600 (pfkA2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:paw03019]
    PAZ_c23600 (pfkA2)
Enzymes [BR:paw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PAZ_c23600 (pfkA2)
Protein phosphatases and associated proteins [BR:paw01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PAZ_c23600 (pfkA2)
Messenger RNA biogenesis [BR:paw03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     PAZ_c23600 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AEE73471
LinkDB All DBs
Position
2387332..2389578
Genome map
AA seq 748 aa AA seqDB search
MRLTPTLPDGHGLRIGILTSGGDAQGMNAAVRAVVRSALSVGAEVYAIYEGYQGMIDGGD
GIRRFGWDDVGSILNRGGTVIGTFRCKGMRERPGRLKAVRNLLEHGIDRLVVIGGDGSLT
GLDVLRTEWTDLVAELVDTGQVSAEVAREHPALMIAGLVGSIDNDLVGSDMTIGADTALH
RIVDAIDDLASTAASHQRSFVVEVMGRHCGYLALMAAVAGGADYVLIPERPPEDGWEDRM
CAELKRGRQAGRRDSIVVVAEGATDRSGNRISSEYVRQVLEDKLGEDARVTILGHVQRGG
RPSAYDRWASTWLGYHAVHEVLSTTPEAEGRVIGTGSNRIHRLPLVKAVADTKSVPGLIT
EGRYNEAMRMRGRSFVEMDAIFTELSEPARTTSDTAGDADRKRVAIMHAGGPAPGMNTAA
RAAVRLAISRGHTVVGIHNGFIGLATGDMSELAWSDVEGWAGEGGAELGTRREIPSTRDL
YAVSRALEDHHIDALLVIGGYSAYEGIYTMMTERDRYPAFRIPTVCIPASIDNNLPGSEL
SIGTDTALNVIVEAMDKIKESGIASRRCFVVETMGRDCGYLALMSGIAAGAERIYTNEDG
ISLDDLANDVHWLRESFAHGRRLFLAVRNENASHNYTTDFIARLLEEESHGMYDVRQVVL
GHMQQGGSPSPFDRLLANRLGYRALNLIDDELAAHQDGSWFIGVNESGMRPCSMDTMPSL
IDAAHRRPREQWWLQLRTIARMVSDEVR
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgaggctcacccccactctccccgacggtcatggtctgcgcattggcatcctgaccagc
ggtggcgacgctcagggcatgaacgctgctgtgcgggctgtggtgcgctctgcgctaagt
gtgggagccgaggtctatgcgatatacgagggctaccagggaatgatcgatggtggcgat
ggcatccgtaggttcgggtgggacgacgtcggctcgatcctcaaccgtggcggcaccgtg
atcggaaccttccgttgcaaggggatgcgcgaacgtccggggcgcctgaaggctgtcaga
aatctcctcgaacacgggatcgatcgtctcgtcgtcatcggcggtgacggttcgctcacc
ggcctggatgtgctgcgcaccgaatggacagacctggtcgctgaactcgtcgacaccggc
caggtgagcgccgaggtagcccgggaacaccccgccctcatgatcgccgggctcgtcgga
tccatcgacaatgacctcgtcggatccgatatgaccatcggtgccgatactgctctgcac
cgtattgtcgatgccatcgacgacctcgcctccaccgcggccagccaccagcgatccttc
gtcgttgaggtgatgggccgccactgcggctatctcgcccttatggcagcagttgccggc
ggagctgactatgttcttattccggaacggccgcccgaggacggttgggaggaccgcatg
tgcgccgagctcaaacgtggccgtcaggcgggccgacgcgactcgatcgtcgtagtcgcg
gagggcgccaccgatcgttccgggaaccggatctcctcggagtacgtccgccaggtgctt
gaggacaaactcggtgaggacgcccgggttaccatcctgggccacgtccagcgcggcgga
cgaccgtcagcctatgaccgctgggcgtcgacctggttgggttatcatgcggttcacgag
gtgctctcgaccactccagaggccgaggggcgcgttatcggcactgggtccaaccgcata
catcgcctccccctggtcaaggccgtcgctgacacgaagtcggtgcccggtctcattacg
gagggccgttacaacgaggccatgcggatgaggggacgttcctttgtcgagatggacgcg
atcttcaccgaactcagtgaaccagctcgtaccacttccgacaccgctggtgacgccgac
cgcaagcgcgtcgcgatcatgcacgctggcggtccggccccgggcatgaatactgctgcc
cgtgctgcagtgcgactggcgatttcccgcggtcataccgttgtgggaatccataacggg
ttcatcggactagcgaccggggacatgtcggaattggcctggagcgacgtcgagggctgg
gccggggaaggcggcgctgagctgggtacccgccgcgagatccctagcactcgcgacctt
tatgctgtcagccgcgctctggaggatcatcacatcgacgcgttgctcgtcattggtggc
tactcggcctacgaaggtatctacaccatgatgactgagcgggaccggtacccggctttc
cgtattccgacggtgtgcattccggcttcgatcgacaacaacctccccggttcggaactg
tccatcggcaccgacaccgctctcaacgtcattgtcgaggcgatggacaagattaaagag
tcgggtatcgcgtccagacgctgcttcgtcgtcgagacgatgggtcgtgactgcggatac
ctcgcgctgatgtcgggtatcgcagctggcgctgagcggatctataccaacgaggacggt
atctccctggacgatctagccaacgacgtccattggttgcgggagtcattcgcccacgga
cgacgacttttccttgccgtgcgcaacgagaacgcatcgcacaattacaccaccgacttc
atcgcgcggctgctggaggaggaatcacacggcatgtatgacgtacgccaggtggtacta
gggcatatgcagcaaggcggctcaccctcacctttcgaccgcttgctcgccaaccgactc
gggtatcgcgctctcaatctcattgacgacgagttggcggcgcatcaggacggttcatgg
ttcattggcgtcaacgagtcgggcatgcggccctgttcgatggacaccatgccctctctc
attgacgccgctcatcgtcgtccccgcgaacagtggtggctgcaactgaggactattgcc
aggatggtctcggacgaggtgcggtaa

DBGET integrated database retrieval system