KEGG   Cutibacterium acnes 266: PAZ_c24400Help
Entry
PAZ_c24400        CDS       T01971                                 

Gene name
ddl2
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
paw  Cutibacterium acnes 266
Pathway
paw00473  D-Alanine metabolism
paw00550  Peptidoglycan biosynthesis
paw01100  Metabolic pathways
paw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:paw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PAZ_c24400 (ddl2)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PAZ_c24400 (ddl2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    PAZ_c24400 (ddl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:paw01011]
    PAZ_c24400 (ddl2)
Enzymes [BR:paw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PAZ_c24400 (ddl2)
Peptidoglycan biosynthesis and degradation proteins [BR:paw01011]
 Precursor biosynthesis
  Amino acid ligase
   PAZ_c24400 (ddl2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 ATP-grasp_3 CPSase_L_D2 ATPgrasp_YheCD TTL GARS_A
Motif
Other DBs
NCBI-ProteinID: AEE73545
LinkDB All DBs
Position
2480283..2481266
Genome map
AA seq 327 aa AA seqDB search
MPSLSWHWLNGGMLQPVVVLAGGLSHQRDISLKSGRTVAQALRRVGHEVVEADIDSALIE
TLRANDGAVVFPMLHGGLGENGALLEVLQLMGIPYVGSSPATCRISFDKSIASRAVAAAG
IVTPQQVALPHDVFRELGAQTVMRSIAEKFGLPVIVKPARGGSSLGVTKVDGVDDLPQAV
ANAYAYDDMVVVEEFIVGTELAIGMITTSEGTRVLPAVEIRPVGGVYDYSAMYTGGETRL
TAPADISDTAAQTATAMARVVQKELDFSGISRVDAIVDESGRPVFLEAGAAPGMTATSLV
PVAMKAAGLDLGEVCSRLVDDVARNHG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgccatcattgtcttggcactggttgaatgggggcatgttgcaaccagtcgtcgtcctt
gccggaggactcagccaccagcgcgatatctctctgaagtcgggtcgcaccgttgcacaa
gcgctgcggcgggtcggacacgaagtcgtggaagccgatattgactccgcactcattgag
accttgcgtgccaacgacggtgccgtcgtgtttcccatgttgcacggtggtcttggcgaa
aatggtgcccttcttgaagtacttcagctcatgggcatcccctatgtgggctccagtcca
gcaacctgccgtatctctttcgataagtccatcgcatctcgcgccgtggccgcagccggg
atcgtcacaccacagcaggtcgcgttaccccatgacgtcttccgtgagcttggcgctcag
acggtcatgcgttcgatcgccgaaaagtttggccttccggtcatcgttaagccggcacgt
gggggctcaagcctcggcgtcacaaaagtcgatggcgtcgacgatcttcctcaggccgtc
gcgaacgcctatgcctatgacgacatggttgtagtcgaggaattcattgtgggcactgag
ctcgcaataggcatgatcacgacgtctgaaggcacgcgtgtgctgccagccgtcgagatt
cgccctgtcggtggtgtttatgattattcagcgatgtacaccggtggtgagacacgacta
acagctcctgcagacattagcgatacagcggcccaaaccgcgacggcgatggcccgagtc
gtgcaaaaggagctcgatttctccgggatatctcgtgtcgatgcgatcgtggacgagtcc
ggtcgcccagttttcttggaggccggtgctgctcccgggatgacagctacttcgctcgta
cccgtggctatgaaagccgccggtctagaccttggcgaggtgtgctctcgactcgtcgat
gacgtcgctcgcaaccatggctga

DBGET integrated database retrieval system