KEGG   Cutibacterium acnes TypeIA2 P.acn31: TIA2EST36_07465Help
Entry
TIA2EST36_07465   CDS       T01655                                 

Gene name
infB
Definition
(GenBank) translation initiation factor IF-2
  KO
K02519  translation initiation factor IF-2
Organism
pax  Cutibacterium acnes TypeIA2 P.acn31
Brite
KEGG Orthology (KO) [BR:pax00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pax03012]
    TIA2EST36_07465 (infB)
   03029 Mitochondrial biogenesis [BR:pax03029]
    TIA2EST36_07465 (infB)
Translation factors [BR:pax03012]
 Eukaryotic type
  Initiation factors
   MTIFs
    TIA2EST36_07465 (infB)
 Prokaryotic type
   TIA2EST36_07465 (infB)
Mitochondrial biogenesis [BR:pax03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    TIA2EST36_07465 (infB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF-2 GTP_EFTU IF2_N GTP_EFTU_D2 MMR_HSR1 Ras SRPRB Roc Arf RsgA_GTPase PduV-EutP FeoB_N SIS_2
Motif
Other DBs
NCBI-ProteinID: AEW84073
LinkDB All DBs
Position
complement(1593890..1596784)
Genome map
AA seq 964 aa AA seqDB search
MAKVRVYELAKELGLSSKQLLGKLNDMGEFVRSASSTIEAPVVRRLRDQIGSAEPADDAK
AAKPAARKSQTSSKKTSKETTTAKPAPGPKPGPGPKPTPGPRPGSSSGPKPGRSSAARTS
ATPRPGLIKSSGASSQQEPPAAKPESKPTPKPGQNVPKPHAPAPKPKPGAPSKSPKPGAR
PGPRPGGSAGLPSAARPGPRPGAGRRTGAPRPGNNPFASSQGMGQSRHRSEGGQRSGGSR
SGQGERMPRPGGSQGSRGGSGMPRPNPAMMPKHQSSQIGQATTGRGGRGGGRGRGGSRGS
GFGGGFGGGPRGPIGGGRGGRGGRGTQGAFGRGGGGRRGRKSRKQRRQEFDEMQAPLVGG
VRVRKGNGETVRLRRGASLTDLAEKINAEPAQLVQVLFNLGEMVTATQSVSDDTLEILGG
ELNYQIQVVSPEDEDRELLESFDLEFGEDEGDDSDLVARPPVVTVMGHVDHGKTKLLDAL
RHTDVVKGEAGGITQAIGAYQVQTEVDDAERAITFIDTPGHEAFTAMRARGAQSTDIAVL
VVAADDGVMPQTVEALNHAKAADVPIVVAVNKIDKPEADPDKVRGQLTEYGLVPEEYGGD
TMFVNVSARTHEGLDDLLEAIVLTADAALDLRANPDMAAQGVAIEAHLDKGRGPVATALI
QRGTLHIGDSIVAGSSYGRVRAMINDQGESVDEAAPATPVQVLGLTSVPGAGDNFLVVDD
DRKARQIAEKREARMRAAQQARSSRRKTLDQLFEQLEKGETEELLLILKGDGAGSVEALE
DALAKIDVGDEVDLRVIDRGVGAITETNVSLAAASNAVIVGFNVRPTAHAQRMADEENVD
IRYYSVIYDAIDEIEAALRGMLKPIYEEKAMGTAEIRQIFRSSKVGTIAGCMITDGTIRR
HAKARLVRDGVVVQETEINTLQREKDAVTEVREGYECGLTLTNYSDIHVGDEVQCYEMVE
KPRD
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
gtggccaaggtccgcgtctatgagctcgcgaaggagctcggactgtcaagcaagcagctt
ttggggaagctcaacgatatgggcgagtttgtccgctcggcttcctcaactattgaggca
ccagttgtgcgacgactacgtgatcagatcggttctgctgaaccggccgatgacgccaaa
gccgcgaagccggcggcgcgtaagtcgcagacgtcttctaagaagacttccaaggagacc
acgacggccaagccggctcccggtcccaaaccggggcccgggccgaagcccacgcctggt
cctcgccccggttctagcagtggccccaagcctggtcgcagctctgcagcacgtaccagt
gcgactccacgtccgggtctcatcaaatcctccggcgcttcatcccagcaggagcccccc
gcagcgaagccggagtccaagccgactccgaagccgggtcagaatgttcccaagccccac
gctccggccccgaagccgaagcctggcgcgccatcgaagtctccgaagccgggtgcccgt
ccggggccgcgaccgggtggatccgctggattgccttcggctgctcgtcccggtccgcgt
ccgggcgccggtcgtcgtaccggagctccgcgtcccggaaataacccgttcgcctccagt
cagggcatggggcaaagtcgtcatcgttctgagggcggacaacgttccggtggatcccgg
tccggtcagggtgagcgtatgccccgtccgggtggcagccagggatcgcgcggcggttcc
ggtatgccgcgcccgaacccggccatgatgccgaaacaccagtcctcgcagatcggtcag
gctactaccggacgtggtggacgtggtggtggccgtggtcgcggtggatcccgcggtagc
ggttttggcggcggcttcggcggtgggcctcgtggtcctatcggaggtggtcgtggtggc
cgcggtggtcgtggtacccagggtgccttcggacgcggtggcggcggccgtcggggtcgt
aagtcccgtaagcagcgcaggcaagagtttgatgagatgcaagcaccgctggtcggcggt
gtgcgcgtccgtaagggcaatggcgagaccgtccgactgcgccgtggtgcttcgctaacc
gatttggccgagaagattaatgccgagccggcacagctggtgcaggtgttgttcaatctg
ggcgagatggtcacggctacccagtcggtatctgacgacaccctggagatcctgggcggc
gagctcaactaccagatccaggtcgtgtccccagaggacgaggaccgcgagctgctggag
tccttcgatctcgagtttggtgaggacgagggcgacgactctgacctcgttgcacgtccc
cccgttgttaccgtcatgggtcacgttgaccacggcaagacgaagctgttggacgccctg
cgccataccgacgtggtgaaaggcgaggccggtggtatcactcaggccattggcgcttat
caggttcagaccgaggtcgacgacgccgagagggctatcaccttcatcgatactcctggc
cacgaggcgttcacagctatgcgtgctcgcggtgcccagtccaccgatatcgcggtgctc
gtcgtggctgctgatgacggcgtgatgcctcagaccgttgaggctttgaaccacgcgaag
gctgctgatgtaccgattgtggtagccgtcaataagatcgataagcctgaggctgatccg
gataaagtccgtggacagctcaccgagtacggcttagtgccggaggagtacggcggcgac
acgatgttcgtcaatgtctctgctcgtacccatgagggtctcgatgatcttctcgaggcg
atcgtgctgactgccgacgcagcccttgatctgcgtgccaatcccgatatggccgctcag
ggcgttgccattgaggctcacctcgataaggggcgtggtccggtggccaccgccctgatc
cagcgtggcaccctgcatattggcgattccatcgttgccgggtcctcctatggacgtgtg
cgcgccatgatcaatgatcaaggtgagagcgtcgacgaggctgctccggctaccccggtg
caggttcttgggttgacctccgtacccggcgctggcgacaacttcctggttgtcgacgac
gaccgcaaggcgcgccagattgctgaaaagcgtgaggcccgcatgcgtgctgcccagcag
gccaggtcgtcgcgtcgcaagacccttgaccagctgtttgagcagttggagaagggcgag
accgaggagttgctgctcattctcaagggtgacggtgctggttcggttgaggcgctcgag
gatgccctggccaagatcgatgtgggcgacgaggttgacctgcgcgttattgaccgcggc
gtcggtgccattaccgagaccaatgtctcgctggctgccgcttccaacgccgtcatcgtg
ggcttcaacgttcgcccgaccgcccatgcccagcgtatggctgacgaggagaacgttgac
attcggtactactcggtcatctacgacgccatcgatgagatcgaggccgccctgcgaggc
atgctcaagccgatctacgaggagaaggcaatgggcaccgcggagatccgccagatcttc
cgctcctcgaaggttggaacgatcgcgggctgcatgatcaccgacggcaccatccgtcgt
catgccaaggcccgcctggtgcgcgacggcgtggtggtccaggaaaccgagatcaacacg
ctgcagcgcgagaaggacgccgttaccgaggtgcgcgagggttacgagtgtggcctgacc
ttgaccaactactccgatattcacgttggtgacgaggttcagtgctacgagatggttgag
aagcctcgcgactga

DBGET integrated database retrieval system