KEGG   Photorhabdus asymbiotica: PAU_00063Help
Entry
PAU_00063         CDS       T00941                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase [mn] (mnsod)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pay  Photorhabdus asymbiotica
Brite
Enzymes [BR:pay01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PAU_00063 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: CAQ82156
UniProt: C7BTZ4
LinkDB All DBs
Position
66060..66749
Genome map
AA seq 229 aa AA seqDB search
MIMLFTEMWTWNHSYMTGVHDMSYSLPSLPYSYDALEPHFDKQTMEIHHTKHHQTYINNT
NSALEACPELAKLDIDDLIQQLDKIPADKRTFVRNNAGGHSNHSLFWKGLKLKTTLKGPL
KEAIERDFGSVDVFKEKFEQAAATRFGSGWAWLVLKDDGKLAIVSTANQDSPLMGEAISG
ASGYPIIGLDVWEHAYYLQYQNRRPDYIKAFWHVVNWDEAAERYQAKVK
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgttgttcacagagatgtggacttggaatcattcttatatgactggagtacat
gatatgagctattcattaccttctcttccttattcttatgacgctctggaacctcatttt
gataagcagacgatggaaatccaccataccaagcaccatcagacttacattaataatacc
aatagtgctttggaggcttgccctgagctggcaaaacttgatattgatgatttgatccag
caattagataagataccggcggataaacgtacttttgtacgcaacaatgctggtggtcat
tctaatcacagtctgttttggaagggactgaaattaaaaacaacgctgaaaggcccattg
aaagaagctattgaacgtgatttcggtagcgttgatgtttttaaagaaaaatttgagcag
gcagcagctacccgttttggttctggttgggcgtggctggtgctgaaagatgatggtaaa
ctggcgattgtctctactgctaatcaggacagcccattaatgggtgaagctatttctggt
gcatctggctatccgattattggtttggatgtttgggaacatgcctattacctgcagtat
caaaaccgtcgtcctgactacattaaagcgttctggcatgtcgttaactgggatgaagct
gcagaacgttatcaggcaaaagtaaaataa

DBGET integrated database retrieval system