KEGG   Photorhabdus asymbiotica: PAU_00342Help
Entry
PAU_00342         CDS       T00941                                 

Gene name
tufA
Definition
(GenBank) elongation factor tu-b (ef-tu-b)
  KO
K02358  elongation factor Tu
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:pay03012]
    PAU_00342 (tufA)
   03029 Mitochondrial biogenesis [BR:pay03029]
    PAU_00342 (tufA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pay04147]
    PAU_00342 (tufA)
Translation factors [BR:pay03012]
 Eukaryotic Type
  Elongation factors
   PAU_00342 (tufA)
 Prokaryotic Type
   PAU_00342 (tufA)
Mitochondrial biogenesis [BR:pay03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    PAU_00342 (tufA)
Exosome [BR:pay04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PAU_00342 (tufA)
  Exosomal proteins of breast cancer cells
   PAU_00342 (tufA)
  Exosomal proteins of colorectal cancer cells
   PAU_00342 (tufA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW Lsm_C
Motif
Other DBs
NCBI-ProteinID: CAQ82435
UniProt: C7BI77
LinkDB All DBs
Position
370622..371806
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKKYGGNARAFDQIDNAPEEKARG
ITISTSHVEYDTPSRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPVIRGSALKALE
GEAEWEDKILELAEALDSYIPEPERAVDQPFLLPIEDVFSISGRGTVVTGRVERGIVKVG
EEVEIVGIKDTAKTTCTGVEMFRKLLDEGRAGENVGVLLRGTKRDEIERGQVLAKPGSIK
PHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIQMK
VTLIAPIAMDQGLRFAIREGGRTVGAGVVAKVIA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgttaacgttggtactatcggccac
gttgaccatggtaaaactaccctgactgctgcaattactactgtattggcaaaaaaatac
ggtggtaacgctcgtgcattcgaccagatcgataacgcaccagaagaaaaagcgcgtggt
atcaccatttctacttctcacgtagaatacgataccccaagccgtcactatgcacacgtt
gactgcccaggccacgctgactatgtaaaaaacatgatcaccggtgcggctcagatggac
ggcgcgatcctggtagttgcggcgactgatggtccaatgccacagactcgtgagcacatc
ctgttaggtcgtcaggtaggcgttccttacatcatcgtattcctgaacaaatgtgacatg
gtagacgacgaagagctgctggaactggttgagatggaagtgcgtgagctgctgtctcag
tacgatttcccaggcgatgataccccagttatccgtggttctgcgctgaaagcactggaa
ggtgaggcagagtgggaagataaaatccttgagctggccgaagcgctggacagctacatc
ccagaaccagagcgtgcagttgaccagccattcctgctgccaatcgaagacgtattctct
atctcaggccgtggtaccgtggtgaccggtcgtgtggagcgcggtatcgttaaagtgggt
gaagaagttgagatcgtgggtatcaaagatacggcgaagaccacttgtacgggtgtagaa
atgttccgcaaactgctggacgaaggtcgtgcaggtgagaacgttggtgttctgctgcga
ggtacaaaacgtgacgaaatcgaacgtggccaggtactggcaaaacccggttcaatcaag
ccacacaccacatttgaatcagaagtttatattctgagcaaagatgaaggtggccgtcat
acgccattcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgacagga
accattgaactgccagaaggcgtagaaatggtaatgccaggtgataacattcagatgaaa
gtgaccctgattgcgccaatcgcaatggatcaaggtctgcgtttcgctatccgtgaaggt
ggccgtacagtgggtgctggtgttgttgctaaagttatcgcataa

DBGET integrated database retrieval system