KEGG   Photorhabdus asymbiotica: PAU_01940Help
Entry
PAU_01940         CDS       T00941                                 

Gene name
gst
Definition
(GenBank) glutathione s-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00480  Glutathione metabolism
pay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PAU_01940 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pay02000]
    PAU_01940 (gst)
Enzymes [BR:pay01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     PAU_01940 (gst)
Transporters [BR:pay02000]
 Other transporters
  Pores ion channels [TC:1]
   PAU_01940 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_3 GST_C_2 Tom37 GST_C_6
Motif
Other DBs
NCBI-ProteinID: CAQ84032
UniProt: C7BHT5
LinkDB All DBs
Position
complement(2177911..2178516)
Genome map
AA seq 201 aa AA seqDB search
MKLYYQPGACSLSPHIVLREAGFDFSIVKVDLKTKKMENGDDFLAVNPKGQVPTLLLDNN
EILTEGSVIVQYIADQKPDRQLIAPAGTMERYHQLEWLSFISSEIHKGFSPLFLPGTPEN
YFPIVINQLLKKFTHVDKVLAKQPYIAGNHFTVADAYLFTVSNWAPLVNVDLSNLLHLKA
YRERIAERPNVRDALKAEGLI
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtattaccaacccggagcttgttccttatctcctcacatcgtacttcgcgaa
gcgggatttgatttcagcattgttaaagttgatttgaaaaccaaaaaaatggagaacggc
gacgattttctcgcagttaaccctaaaggccaagtaccaactctcctgctagacaacaat
gagatacttactgaaggatcagttatcgttcaatatattgcagaccagaagccggacaga
caactgattgcaccagccggaactatggaacgatatcatcaacttgaatggcttagcttt
atttccagtgaaattcacaaaggattctcaccactgtttttaccaggaacaccagaaaat
tatttcccaattgttattaatcaattactgaaaaaattcactcatgtggataaagtatta
gcaaaacagccctatattgccggaaatcattttactgttgctgacgcctatttatttact
gtcagtaattgggcacctttggttaacgtggatctatccaatctgttacatcttaaagcc
tatcgggaaagaattgcagaacgtccgaatgttcgtgatgcattaaaagctgaaggatta
atttga

DBGET integrated database retrieval system