KEGG   Photorhabdus asymbiotica: PAU_03165Help
Entry
PAU_03165         CDS       T00941                                 

Gene name
dacA
Definition
(GenBank) penicillin-binding protein 5 precursor
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00550  Peptidoglycan biosynthesis
pay01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PAU_03165 (dacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pay01002]
    PAU_03165 (dacA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pay01011]
    PAU_03165 (dacA)
Enzymes [BR:pay01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PAU_03165 (dacA)
Peptidases [BR:pay01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   PAU_03165 (dacA)
Peptidoglycan biosynthesis and degradation proteins [BR:pay01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   PAU_03165 (dacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase FAA_hydrolase
Motif
Other DBs
NCBI-ProteinID: CAQ85253
UniProt: C7BH87
LinkDB All DBs
Position
3726814..3728100
Genome map
AA seq 428 aa AA seqDB search
MLVFFFICYDVARYQPFLTDVVQSTMKYTTTSRFIKSVTLGIALAMNVSAFANGNDVNLK
TMIPGVPQIDAEAYILIDYNSGKVLAEMNADSHRDPASLTKMMTSYVIGQAIKSGKIGPN
DMVTVGTDAWATGNPVFKGSSLMFLKPGDQVSVSMLSRGINLQSGNDACVAMADYVAGSQ
ESFVNLMNGYVKSLGLQNTNFKTVHGLDAEGQYSSARDMALIGQALIRDVPEEYAIYKEK
EFTYNNIRQTNRNGLLWDKSLNVDGIKTGHTNAAGYNLVASATEGDMRLISAVLGGHTYK
GRETESKKLLTWGFRFFETVAPLKADKEFASEPVWFGDSDRVQLGVDKDVYLTIPRGRLK
DLKASYVMNDTELHAPLAKNQVVGTINFQLDGKTVEQRPLVVMNEVKEGGIFSRFIDYIK
LLFHHWFG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgttagtattttttttcatttgctatgatgtggcccgatatcaaccttttctcacggat
gttgtccaatcgaccatgaaatacacaaccacttctcgttttataaaaagcgtcaccttg
ggtattgcgctggcaatgaacgtttctgcctttgccaatgggaacgatgtaaacctgaaa
acgatgatcccaggtgtgccccagattgatgctgaagcttatattcttatcgactacaac
tcaggcaaagttctggctgaaatgaatgcagattcacatcgtgaccctgccagcctgaca
aaaatgatgaccagttatgttattggtcaggcaatcaaatcaggcaaaattgggccaaat
gatatggtcaccgttggtactgatgcatgggcaacaggtaatccggtatttaaaggctct
tccctgatgttcctcaaacctggagatcaagtctcagtttccatgctatcccgtggtata
aatttgcaatccggtaatgatgcttgtgttgcaatggcagattatgttgctggtagccaa
gagtcgtttgttaatctgatgaatggctacgtaaaatcacttggcttacagaatacgaat
ttcaaaactgttcatggtctggatgcggaaggccagtatagctctgcccgtgatatggca
ttgattggtcaagcgctaatccgcgatgttcccgaagaatatgctatctataaagaaaaa
gaatttacctacaacaacatccgtcagacaaaccgcaacggtttgttgtgggataaaagc
ctaaatgtagatggtatcaaaaccggtcacaccaatgcagcaggttataacttagtcgct
tctgcaactgaaggtgatatgcgtctgatttctgcggtactaggcggtcacacttataaa
ggacgtgagacagaaagtaaaaaactgctaacctggggttttcgtttctttgaaaccgtt
gctccactgaaagctgacaaagaatttgcctctgaacctgtctggtttggagacagcgat
agggttcagctaggcgttgataaagatgtttatctgactattcccagaggacgtttgaaa
gatctgaaagccagctatgtcatgaatgatactgaattacatgccccactagcgaaaaat
caagttgtcggtacgatcaactttcaacttgatggcaagaccgttgaacaacgtcctttg
gttgtcatgaatgaagtgaaagaaggcggtattttcagccgttttatcgactatatcaaa
ctgctgtttcatcattggtttggctaa

DBGET integrated database retrieval system