KEGG   Photorhabdus asymbiotica: PAU_03184Help
Entry
PAU_03184         CDS       T00941                                 

Gene name
emrA
Definition
(GenBank) multidrug resistance secretion protein
  KO
K03543  membrane fusion protein, multidrug efflux system
Organism
pay  Photorhabdus asymbiotica
Brite
KEGG Orthology (KO) [BR:pay00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pay02000]
    PAU_03184 (emrA)
Transporters [BR:pay02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   PAU_03184 (emrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyD HlyD_D23 HlyD_3 Biotin_lipoyl_2 Orf78 DUF2776 DUF3328
Motif
Other DBs
NCBI-ProteinID: CAQ85272
UniProt: C7BHA6
LinkDB All DBs
Position
3743270..3744448
Genome map
AA seq 392 aa AA seqDB search
MSANQEVQAPQNPTSSKKRQRSRALVLLTLVFTLLGVAYFFYWFIVLRHHQETDNAYVTG
NQVQIMSQVAGSVITVHFDNTDFVKSGSVLVQLDPRDAELALEKAKTALASSVRQTHQQM
INSKQYQANIALRRSELTRVQSDLSRREVLGAQKVIGKEELQHAREAVASAKATLDVAVE
QYNANQAVILDTPLEKQPAVEQAATDVRNAWLALQRTKIVSPVDGYVSRRSVQIGAQINK
NTPLMAIIPAYNMWIEANFKETQLANMRIGQPAEITSDFYGKDKIFNGKITGLDMGTGSA
FSLLPAQNASGNWIKVVQRLPVRIELNPEQLEKYPLRIGLSTKVRVDTTHSDGQVLSNRT
RTKSAYHTTALTIDMSPANKIVTDIINNNAGK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcaaatcaggaagtgcaagcaccacaaaatccaaccagtagcaaaaaaagacaa
cgcagtcgcgccttagtattactaactcttgtctttactctgctcggcgtagcctatttc
ttttattggtttatcgtcttacgccaccatcaagaaacagataacgcctacgttacaggc
aaccaagttcaaatcatgtcgcaagttgctggcagtgtaattaccgttcacttcgataac
acggactttgtgaaaagcggtagtgtgttagtacaacttgatccccgtgatgcagaatta
gccctagagaaagcaaaaacagcgctcgccagtagtgtccgccaaactcatcagcagatg
attaacagtaaacaatatcaggctaatattgccctgcgccgctctgaattgacccgagtt
caaagtgatctcagccgccgtgaagtgcttggtgctcagaaagtcattggtaaagaagaa
ttgcaacatgcacgagaagccgttgccagcgccaaagcgacattagatgtcgcagtcgaa
caatacaacgctaatcaagcggttattctggacacccctttagaaaaacaaccagcagtt
gaacaagctgcaacggatgttcgcaatgcttggttagcgttgcaacgcactaaaatagtc
agcccagttgatggctatgtctctcgtcgcagtgtacaaattggcgcacaaatcaataaa
aatacaccgctgatggcgataattccggcatacaatatgtggattgaagctaactttaaa
gaaactcagctcgccaacatgcgtattggtcaacccgcagaaatcaccagtgatttttac
ggtaaggacaagatatttaatggcaaaatcacggggcttgatatgggtaccggaagcgct
ttctctttattacctgctcaaaatgctagtggcaattggattaaagttgtccaacgctta
cctgtccgcattgaactgaatcctgaacaattagagaaatacccattacgcattggccta
tctactaaagtaagagtagatactactcattctgatggacaagttctatcaaaccgaaca
cgtactaaatcggcttatcacacaacggctctgacaatagatatgtctccggcaaataaa
atagtcaccgacataattaataacaatgctggaaaataa

DBGET integrated database retrieval system