KEGG   Photorhabdus asymbiotica: PAU_04327
Entry
PAU_04327         CDS       T00941                                 

Gene name
vioA
Definition
(GenBank) aminotransferase, degt/dnrj/eryc1/strs family
  KO
K20429  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase [EC:2.6.1.33]
Organism
pay  Photorhabdus asymbiotica
Pathway
pay00541  O-Antigen nucleotide sugar biosynthesis
Brite
KEGG Orthology (KO) [BR:pay00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    PAU_04327 (vioA)
Enzymes [BR:pay01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.33  dTDP-4-amino-4,6-dideoxy-D-glucose transaminase
     PAU_04327 (vioA)
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2 Cys_Met_Meta_PP Beta_elim_lyase
Other DBs
NCBI-ProteinID: CAQ86414
UniProt: C7BSB6
LinkDB
Position
4985314..4986420
AA seq 368 aa
MDNKSIPVTQPYLPPLEEFIPYLQKIWNNKWLTNNGPFHQELEKELCKYLNVEHISLFTN
ATIALVTALQALRISGEVITTPYSFVATAHSILWNNLTPVFVDIDQKTFNLDPKKIEEAI
TPRTTAIMPVHCYSNPCDVEAIQKIADTYGLRVIYDAAHAFGVQYKDQSLLKYGDLSILS
FHATKVFNTFEGGAIICPDAKTKQRIDYLKNFGFADEITVTAPGINGKMSEVNAAFGLLQ
LKHIDNSISQRSNIDLRYREKLQNIQGITIPKLSDSATSNHSYFPILVEKDYPLTRDELY
QKLKDNNILSRRYFYPLISDMPMYRGLHSSSSNLSNAKEASEKVLCLPIFTSLEKSQQDI
IISLIKDI
NT seq 1107 nt   +upstreamnt  +downstreamnt
atggataacaaaagtatacctgtaacacaaccatatttaccccctctagaagaattcata
ccatacttacaaaagatttggaacaacaaatggttaactaataatggtccatttcatcaa
gagttagaaaaagaactttgcaaatatcttaacgttgagcatatttctttatttactaac
gcaactattgcactagtgacagcattacaggcattacgaattagcggggaagttattaca
acaccttattcgtttgttgctacagcacactcaatcctctggaataatctcacacctgtt
tttgtagatatagatcaaaaaacttttaatcttgatccaaaaaaaatcgaagaagcaatt
acacctcgtacaacagcaataatgcccgttcattgttactctaatccatgcgatgttgaa
gcaattcaaaaaattgctgatacatacggtttacgtgttatttatgatgcagctcacgca
tttggtgttcaatacaaagatcaaagcctattgaaatatggtgatttatccatattaagt
tttcatgccacaaaagtatttaatacatttgagggtggtgcgattatttgtcctgatgca
aaaaccaaacaaagaatcgattacttgaaaaattttggttttgcagatgaaatcaccgtc
accgcacctggtattaatggaaaaatgagtgaagtcaatgctgcatttggtttattacaa
ttaaaacatatagataattcaatttctcaaagaagcaatatcgatttacgttatagagaa
aaactacaaaacatacaaggaatcactattcctaagctatctgattctgcaactagtaat
cattcatattttcctattctagttgaaaaagattatccattaactcgtgatgaactatat
caaaaattaaaagataataatattttatcaagaagatacttctaccctctaattagtgat
atgccaatgtatcgtggtttacattcatcatcatccaatctcagcaatgcaaaagaagcc
tcagagaaagttttatgcttaccaatatttacatctttagaaaaaagtcagcaggatatc
attatatccttaattaaggatatctaa

DBGET integrated database retrieval system