KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_01725Help
Entry
TIA2EST2_01725    CDS       T01656                                 

Definition
(GenBank) Phosphate regulon transcriptional regulatory protein PhoB, Sensory transduction protein regX3
  KO
K07776  two-component system, OmpR family, response regulator RegX3
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:paz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TIA2EST2_01725
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:paz02022]
    TIA2EST2_01725
Two-component system [BR:paz02022]
 OmpR family
  SenX3-RegX3 (phosphate starvation response)
   TIA2EST2_01725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AEW78452
LinkDB All DBs
Position
complement(393632..394312)
Genome map
AA seq 226 aa AA seqDB search
MTRVLIIEDEESYREATAFMLRKEGFEVNTAANGADGLEIYSHNGADIVLLDLMMPGLPG
TEVCRQLRQRGNVGIIMVTARDSEIDKVVGLELGADDYVTKPFSHRELVARIRAVTRRGG
PEIEVSPDVLEESGVRMDVERHEVSVGGTAVRLALKEFDLLEVLLRNAGRVMTRASLIDR
VWGADYVGDTKTLDVHIKRLRAKIEDDPSRPVRIITVRGLGYKFQA
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtgtactcatcatcgaggacgaagagtcctatcgcgaggccaccgccttcatg
ctgcgcaaagagggatttgaggtcaatactgccgccaatggcgctgatggtctcgaaatc
tactcgcacaacggtgccgacatcgtactgctcgacctcatgatgccagggcttccaggg
accgaagtctgccgtcagctacgccagcgcggcaatgtcgggatcatcatggtgacggct
agggattcggagatcgacaaggttgtcgggctggagctcggagccgacgactacgtcacc
aaaccgtttagccaccgagaattggtcgcgcgcatccgcgctgtgactcgtcgcggcggc
cctgagatagaggtttcccccgatgtgctcgaggagagcggggtaaggatggacgttgag
cggcatgaggtcagcgtcggcgggacggcagtgcgacttgccctcaaagagttcgaccta
cttgaggtgctgctgcgcaatgcaggacgtgtcatgacccgagcctccctcatcgaccga
gtgtggggagccgactatgttggcgacactaaaactcttgacgtgcacatcaaaaggctg
cgcgcaaagattgaagatgacccatcccgtccggtgcgcatcatcaccgtacgcggactg
ggctacaagtttcaggcctaa

DBGET integrated database retrieval system