KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_07070Help
Entry
TIA2EST2_07070    CDS       T01656                                 

Definition
(GenBank) succinate dehydrogenase/fumarate reductase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00020  Citrate cycle (TCA cycle)
paz00190  Oxidative phosphorylation
paz00650  Butanoate metabolism
paz01100  Metabolic pathways
paz01110  Biosynthesis of secondary metabolites
paz01120  Microbial metabolism in diverse environments
paz01130  Biosynthesis of antibiotics
paz01200  Carbon metabolism
Module
paz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIA2EST2_07070
   00650 Butanoate metabolism
    TIA2EST2_07070
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TIA2EST2_07070
Enzymes [BR:paz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TIA2EST2_07070
    1.3.5.4  fumarate reductase (quinol)
     TIA2EST2_07070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_17 Fer4_7 Fer4_10 Fer4_9 Fer4_18 Fer4 Fer4_6 Fer4_2 Fer4_15 Fer4_4 Fer4_16 Fer4_3 Fer4_21 Fer2 Fer4_13 Fer4_22
Motif
Other DBs
NCBI-ProteinID: AEW79499
LinkDB All DBs
Position
complement(1520426..1521199)
Genome map
AA seq 257 aa AA seqDB search
MKINLRIWRQRNSKDQGRLVEYTLDGVSGDMSFLEMLDMLNENLTAQGEEPVAFDSDCRE
GICGQCGVVINGVPHGGMGAAQPVRTTTCQLHMRSFADGSTITIEPWKSGAFPILRDLIV
DRSALDRVIQAGGYVSVNTGAAPDAHAVQVNKKRSDRSFDAATCIGCGACVAACPNGSSM
LFTSAKITHLAMLPQGQPERMRRVKAMAAQNDAEGFGGCTNIGECASVCPKGIPLESISQ
LNRDLIASLFKHDGKDD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcaacctgcgaatctggcgtcagcgcaattccaaggatcagggccgcctcgtc
gagtacaccctggacggtgtttccggtgatatgtccttccttgagatgttggacatgctc
aacgagaacctcaccgctcagggtgaagagcccgtcgcatttgactcggactgccgcgag
ggtatttgcggtcagtgcggcgtcgtcatcaatggtgtgccgcacggtggtatgggtgct
gcccagccggtgcgtaccactacgtgtcagctccacatgcgctccttcgccgatggctcg
accatcacgatcgagccatggaagtcgggtgccttcccgattctgcgtgaccttatcgtg
gatcgctcggcccttgaccgtgtcatccaggctggcggctatgtctcggtgaacaccggt
gctgccccggacgctcacgctgttcaggtcaacaagaagcgctctgaccgctccttcgac
gccgctacctgcatcggttgtggcgcctgcgtggcggcctgcccgaacggctcctcgatg
ctgtttacttctgcgaagatcactcacctggccatgcttccgcagggtcagccggagcgg
atgcgtcgtgttaaggctatggctgcgcagaacgacgctgaaggattcggtggctgcacc
aacattggtgagtgcgcctcggtgtgcccgaaaggtattccgctggagtccatcagccag
ctcaaccgcgacctcattgcgtcgctgttcaagcacgacggcaaggacgactga

DBGET integrated database retrieval system