KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_07075Help
Entry
TIA2EST2_07075    CDS       T01656                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Pathway
paz00020  Citrate cycle (TCA cycle)
paz00190  Oxidative phosphorylation
paz00650  Butanoate metabolism
paz01100  Metabolic pathways
paz01110  Biosynthesis of secondary metabolites
paz01120  Microbial metabolism in diverse environments
paz01130  Biosynthesis of antibiotics
paz01200  Carbon metabolism
Module
paz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
paz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:paz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIA2EST2_07075 (sdhA)
   00650 Butanoate metabolism
    TIA2EST2_07075 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    TIA2EST2_07075 (sdhA)
Enzymes [BR:paz01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     TIA2EST2_07075 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     TIA2EST2_07075 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 GIDA HI0933_like NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEW79500
LinkDB All DBs
Position
complement(1521196..1523223)
Genome map
AA seq 675 aa AA seqDB search
MTATAASNNNAALADQYWTTGDEIHDTKANHDLPIEKIWTDRQFTSRLVNPANRRKMTVI
IVGTGLAGGAAAATLGEAGYRVENFCYQDSPRRAHSIAAQGGINAAKNYKNDGDSIYRLF
YDTVKGGDYRSRETNVYRLAAVSANIIDQCVAQGVPFAREYGGLLDNRSFGGVQVQRTFY
ARGQTGQQLLIGAYQALERQVHAGTVHMHTRHEMVELIVADGRARGIVTRDMVTGKIEEW
FGDAVVLATGGYGNVFFLSTNAMGCNATASWRAHRKGAYFGNPCYTQIHPTCIPVHGENQ
SKLTLMSESLRNDGRIWVPKRAEDCEKDPRDIPEEDRDYYLERIYPSFGNLVPRDIASRQ
AKYRCDEGRGVGPKVREVDSDGTEHMRARGVYLDFSEAIQRMGKDAVEKKYGNLFDMYQR
ITDENPYEVPMRIYPAVHYTMGGLWVDYDLQSTIPGLFVCGEANFSDHGANRLGASALMQ
GLADGYWVLPNTITDYLADSPKFGMVDEKHPSAVEARQAVESRINKLLTINGTRTVDSIH
KELGHIMWEYCGMERSEAGLIKAIGLIRNLRNEFWTNVKVTGVNEELNQTLERAGRLADF
LELGELMCIDALHRRESCGGHFRAESQTEEGEAMRHDDEYQYVAAWEWTGEGHKPTLHKE
PLVYKSIQVKQRSYK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaactgctgcatccaataacaacgccgctctcgccgaccagtactggacgacc
ggcgacgaaatccacgacacgaaggccaaccatgaccttccgatcgagaagatctggact
gatcgccagttcacctcgcgtctggtcaacccggctaaccgtcgcaagatgacggtcatc
attgttggtaccggtctagctggtggcgctgccgccgcaactctcggtgaggccggttac
cgcgtcgagaacttctgctaccaggactctccgcgtcgcgctcactcgatcgcggcccag
ggcggaattaacgccgcgaagaactacaagaatgacggtgattcgatctaccgcctgttc
tacgacaccgtcaaaggtggcgattaccgctcccgcgagacgaacgtttaccggctcgcc
gcggtcagcgcgaacatcatcgaccagtgtgtcgcccagggcgttccgttcgcccgtgag
tacggtggcctgctcgacaaccgttccttcggtggcgtccaggtgcagcgcaccttctac
gctcgcggccagacgggccagcagctgctcatcggcgcctaccaagccctcgagcggcag
gttcacgccggcaccgtgcacatgcacacccgtcacgagatggtcgagctcatcgtcgcc
gacgggcgagctcgcggcatcgtgactcgtgacatggttaccggcaagatcgaagagtgg
tttggtgatgccgtcgtcctggctaccggtggttacggcaacgtcttcttcctgtcgacg
aacgccatgggctgcaatgccaccgcctcgtggcgtgcccaccgtaagggcgcttacttc
ggcaacccctgctacacccagatccacccgacctgcatcccggtgcatggtgaaaaccag
tcgaagctgactctgatgtcggagtcgctgcgtaacgacggccgtatctgggtgcccaag
cgcgcggaagattgtgaaaaggatcctcgcgacatccccgaggaagatcgcgactactac
ttggagcgcatctacccgtccttcggcaacctggttcctcgtgacattgcatcccgtcaa
gccaagtaccgctgtgacgagggtcgtggtgtcggtccgaaggttcgtgaggtcgattct
gacggcaccgagcacatgcgtgcccgtggtgtgtacctcgacttctccgaggccatccag
cgtatgggtaaggatgccgtggaaaagaagtacggcaacctcttcgacatgtaccagcgg
attaccgacgagaacccgtatgaggttcccatgcgtatctaccctgcggtgcactacacg
atgggtggcctgtgggtcgactatgacctgcagtcgaccattccgggtctgtttgtctgt
ggtgaggccaacttctccgatcacggcgctaaccggctcggtgcttcggccctgatgcag
ggtctggctgatggctactgggtgctgcccaacaccatcaccgattacctggcggactct
ccgaagttcggcatggtcgatgagaagcatccgtccgcggttgaagcccgtcaggctgtc
gagagccgtatcaacaagctgctaacgattaatggaacccgtaccgtcgactcgatccac
aaggaacttggccacatcatgtgggagtactgcggtatggagcgcagcgaggccggcctc
attaaggctattggtctcatccgcaatctgcgcaacgagttctggaccaacgttaaggtc
accggcgtcaacgaggagctcaatcagaccctcgagcgcgctggtcggctcgccgacttc
ttggagctcggtgaactgatgtgcatcgacgctctacaccgtcgcgagtcttgtggtggt
cacttccgcgctgagtctcagaccgaagagggcgaggccatgcgtcacgacgacgagtat
cagtacgtcgctgcctgggagtggactggcgaaggccacaagccgaccctgcacaaggag
ccgctggtctacaagtccatccaggtcaagcagaggagctacaagtga

DBGET integrated database retrieval system