KEGG   Cutibacterium acnes TypeIA2 P.acn33: TIA2EST2_09680Help
Entry
TIA2EST2_09680    CDS       T01656                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
paz  Cutibacterium acnes TypeIA2 P.acn33
Brite
KEGG Orthology (KO) [BR:paz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TIA2EST2_09680
Enzymes [BR:paz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     TIA2EST2_09680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like DAO Thi4 FAD_binding_3 FAD_oxidored NAD_binding_8 AlaDh_PNT_C K_oxygenase FMO-like
Motif
Other DBs
NCBI-ProteinID: AEW80004
LinkDB All DBs
Position
2109287..2110861
Genome map
AA seq 524 aa AA seqDB search
MLDNALTTQLKTYLEMVREPIVLVPSPYRGDDAAKSSKSAHMDELLSEIAALSDKVSVGK
PVDNERTPSFAITRPGSPIDIRFAGLPMGHEFTSLVLALLQVGGHPVKEEQSLIDAVRAV
KGEHHFVTYMSLTCQNCPTVVQDLNAMAVLNPNIHHTAVDGGTHTNEVEAKGIASVPAIY
LDGEDWGSGRMDMAEILERLDADAAQGAKEDLSQRDPYDVLVVGAGPAGAAAAVYAARKG
IRTAMVGSRIGGQVLDTEAIDNLISVPHTTGPRLADALRSHVNDYNIDVIERQTASAIET
TGGMTTVHLTDGDLRARSVIVATGARWRNLGVPGEKEYRTKGVTYCPHCDGPLFTGKKVA
VVGGGNSGIEAAIDLAGVVDHVTVVEFLDALKADDVLLRTLNSLPNVDVITSARTTQILG
DGSKVTGLEYEDRTSGDVKTIELAGVFVQIGLLPNTEWLEGALERNQRGEIVIDERGTTS
APGIFAAGDCTTQPYKQIIISMGAGATAALGAFDHLIRQNPTQN
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcttgataacgccctgaccactcagctcaagacctacctcgagatggtgcgcgagccg
atcgtcctggtgccttccccataccggggtgacgacgccgcaaaatcgtcaaagtcggct
cacatggacgagcttttatccgagatcgccgccttgtctgacaaagtgagcgtcggtaag
cccgtcgacaatgagcgcaccccctcctttgccatcacccgccccggtagccccatcgac
atccgctttgcgggcctgccgatgggccacgaattcacctcactcgtgctggccctgctg
caggtaggtggacaccccgtcaaggaggagcagtccctcatcgacgccgtgcgcgcggtc
aagggtgagcaccacttcgtcacctacatgtcactaacctgccaaaattgcccgacggta
gtgcaggacctcaacgcaatggccgtcctcaacccgaatattcaccacaccgccgttgac
ggtggcacccacaccaatgaggtagaagccaaaggaatcgcctcggtgccggccatctac
ctggacggcgaggactggggctccgggcgcatggacatggccgaaatcctcgagcgtctc
gacgccgacgccgcccagggagccaaggaagacctctcgcagcgcgacccctacgacgtg
ctcgtcgtaggggcgggtcccgccggtgccgcggccgccgtgtacgcggctcgtaagggc
attcgcaccgccatggtcgggtctcgaatcggcggccaggtactcgataccgaggccatc
gacaacctcatctcggtgccgcacaccaccggtccgcgtctggccgacgccctccgcagc
cacgtcaacgactacaacattgacgttattgagcgtcagaccgccagcgccatagagacc
accggcggtatgaccaccgtgcatctgaccgacggcgacctgcgggcgcgctcagtcatc
gtggccaccggtgcccgctggcgcaaccttggcgtgcctggcgagaaggaataccgcacc
aagggtgtgacctactgcccgcactgcgatggcccgctattcacaggcaaaaaggtggcc
gtcgtcggaggtggaaactccggcattgaggccgctatcgaccttgccggcgtcgtcgac
cacgtcaccgtcgtggagttcctcgacgccctcaaggctgacgacgtactactacgcacc
ctgaactcactgccgaacgtcgacgtcatcacctcggcccgcaccacccagatcctcggc
gacggatccaaggtgaccggtctggagtacgaggaccgcaccagcggcgacgttaagacc
atcgagctagcaggtgtgtttgtccaaatcggtctgctgcccaacaccgaatggctcgaa
ggtgccctggagcgcaaccagcggggagaaatcgtcatcgacgagcgtggcaccacctca
gcccccggaatcttcgccgccggtgactgcaccactcagccgtacaagcagatcatcatc
tcgatgggggccggcgccaccgctgctctaggcgccttcgaccacctcatccgtcaaaat
ccgacacagaactga

DBGET integrated database retrieval system