KEGG   Pseudomonas azotoformans: AYR47_02550
Entry
AYR47_02550       CDS       T04879                                 

Definition
(GenBank) conjugal transfer protein
Organism
pazo  Pseudomonas azotoformans
SSDB
Motif
Pfam: Lzipper-MIP1
Other DBs
NCBI-ProteinID: AMN77271
UniProt: A0A127HS87
LinkDB
Position
540034..541416
AA seq 460 aa
MSRLRARPWLGTMSLVFYGLLAVAAHAHAAEGDYRLGTQGEVLDDRVMYTIGGGSAVGSP
SSLYRPSGLGVGGSWRANMMCGNMSLTNTLQNQLNGVTEGFQQIMGSIVQNATQAVMSLP
ALIIQRANPGLYELLSNGVMQGRIDFDRSKLTCQAMAEKMADKVGQAGWGALAKNQEMQG
NLAQAGGDAVAAVKNTETHNGNNGVSWVGGSKAGGDGQTPIRVTADVVRAGYNLLHNRSV
DDGASISSNDCLGGAICQTWASPQEESEWAVRVLGESEVSTCDSCETLRATAGSGLTPLI
QEAYSERLKALQGLLSGSLSPTPDNLAKASSPMLPVTRGVIEALRDDPDQDLLARRLASE
TALSSVLDKALLLLRTLLAGSHEPNIASAEPAQTALTKNIDALEREIRLLQTELQVRQML
ATNTASLVLDRHAGGADASRTVEQGDPEPGRLNDADAKRK
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgagccggcttcgcgcgcgaccttggttgggcacgatgagtctggtgttctacggactg
ctcgccgtggccgctcatgcccatgccgccgagggcgattaccgcctgggcactcaaggc
gaagtactcgacgaccgagtgatgtacaccattggtggcggctcggcagtcggctctccg
agttcgctctaccgacccagtggtctcggtgtcggcgggtcatggcgagcgaacatgatg
tgcggaaacatgagcctcaccaacaccctgcaaaaccaactgaacggcgtcaccgaaggt
ttccagcagatcatgggcagcatcgtgcagaacgcgacccaggcggtgatgtcgctgccg
gcgttgatcatccagcgcgccaaccccggcctctatgaattgttgagcaacggggtgatg
caggggcgtatcgacttcgatcgttccaaactgacctgccaagccatggccgagaagatg
gcggacaaggtcgggcaagccggctggggcgcgctggccaaaaatcaggagatgcagggc
aatctggcgcaagccggcggtgatgcggtggctgcggtgaaaaacaccgagacccataac
ggcaacaatggggtgtcctgggtcggcggttcgaaggctggtggtgatgggcagacgccc
attcgggtgaccgccgacgtagtgcgcgcgggctacaacctgctgcataatcggtcggtg
gatgacggtgcgtcgatcagtagcaacgactgcctgggtggggctatctgccagacttgg
gcctcgccgcaagaggagtccgaatgggccgttcgcgtgttgggcgagagcgaagtctcg
acctgcgacagctgcgaaaccctgcgtgcaaccgcgggcagcggattgacgccgctgatc
caggaggcctacagcgaacgtctcaaggccctgcaagggctgttgtccggttcactgtcg
cctacccctgacaatctggccaaagcctcaagcccaatgctgccggtgacccgtggcgtg
atcgaagccctacgcgacgatcctgaccaggatctgctcgcgcgacgcctggccagcgag
acggccctgtccagtgtactcgacaaggcactgctgctactgcgcacgctgctggcaggc
agtcacgaaccgaacatcgcctccgccgagccggcccaaaccgccttgacgaaaaacatc
gacgctctggagcgcgaaatacgcctgctgcagaccgaactgcaggtccggcagatgctg
gccaccaacaccgccagcctggtgctcgaccgccatgccggtggcgctgatgcttcgcgg
accgttgagcaaggcgacccggagcccggccgactcaatgatgctgacgccaaacgcaag
taa

DBGET integrated database retrieval system