KEGG   Pseudomonas azotoformans: AYR47_17000Help
Entry
AYR47_17000       CDS       T04879                                 

Definition
(GenBank) DNA polymerase II
  KO
K02336  DNA polymerase II [EC:2.7.7.7]
Organism
pazo  Pseudomonas azotoformans
Brite
KEGG Orthology (KO) [BR:pazo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pazo03400]
    AYR47_17000
Enzymes [BR:pazo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AYR47_17000
DNA repair and recombination proteins [BR:pazo03400]
 Prokaryotic Type
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    AYR47_17000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol_B DNA_pol_B_exo1 DNA_pol_B_2 RNase_H_2 P63C
Motif
Other DBs
NCBI-ProteinID: AMN79904
UniProt: A0A127HZB8
LinkDB All DBs
Position
3629556..3631913
Genome map
AA seq 785 aa AA seqDB search
MDLQQGFVLTRHWRDTPAGTEVSFWLATEQGPRFVRLPVQTSVMFIPEAHRKPLDWLLKG
ERDIDLRPLQLCDFHHRPVLGLYTRQHRQAMDVEKRLRAAGVDVYEGDVRPPERYMMERF
ITAPVWFGGTPDANGVLCDAQMKPAPDYRPPLKLVSLDIETTAQGDLYSIALEGCGERQV
YMLGPPNKTDAVDFKLDYCDTRAQLLERLNQWLALHDPDAIIGWNVVQFDLRVLHEHAQR
LNVPLMLGRGEEPMAWREHGSRNHYFAAAAGRLIIDGIEALRSATWSFESFSLENVAQTL
LGEGKDISTPYQRMDEINRMFAEDKPALARYNLKDCELVTRIFEKTELLKFLLERASVTG
LPADRNGGSVAAFTHLYMPLMHRQGFVAPNLGDKPPQASPGGFVMDSRPGLYESVLVLDY
KSLYPSIIRSFLIDPVGLIEGLKYPDDSDSVEGFRGARFSRTRHCLPSIVERVSEGREEA
KREHNAPLSQALKIIMNAFYGVLGSSGCRFFDTRLASSITMRGHQIMRQTRELVEAQGYE
VIYGDTDSTFVWLGSAHSQEDASRIGRALVQHVNDWWREHLLTAFGLQSALELQYETHFT
RFLMPTIRGAEEGSKKRYAGLVVRSDGSEDMVYKGLETVRSDWSPLARRFQQELYQRIFH
RQPHQDYIRDYVRRTLSGEFDELLIYRKRLRRRLDDYERNVPPHVRAARLADEYNDRLNR
PRQYQRGGWISYVISVNGPEPLEVRQAPIDYDHYVTRQLQPVADAILPFVNDDFSTLVGG
QMGLF
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
gtggatttacagcagggttttgtcctgacccggcattggcgcgataccccggcgggcacg
gaggtcagcttctggctggccaccgaacagggcccgaggtttgtccgcctacccgtgcag
acctcggtgatgttcatccctgaggctcatcgcaagccgctggattggctgctcaagggc
gagcgcgatatcgacttgcgcccgttgcagctgtgcgatttccatcaccgccccgtcctc
ggcctgtacacccgccagcaccgccaggcgatggacgtggaaaaacgcctgcgtgcggcg
ggcgtcgacgtctacgaaggcgacgtgcgcccgcccgaacgctacatgatggagcgtttc
atcaccgccccggtgtggttcggcggcacgcccgacgccaacggcgtactgtgcgacgca
cagatgaaacccgcgcccgactaccgtccgccgctgaaactggtgtccctcgacatcgag
accaccgcccagggcgatctctattccatcgccctcgaaggctgcggcgagcgccaggtg
tacatgcttggcccgccgaacaaaaccgacgccgtggacttcaagctcgactattgcgac
acccgtgcccaactgctcgaacgcctcaaccagtggctggcgctgcacgaccccgatgcg
atcatcggctggaacgtggtgcagttcgacctgcgcgtgctgcacgaacatgcccagcgc
ctcaatgtgccgctcatgctcggccggggcgaagaaccgatggcctggcgcgaacacggc
agccgcaatcattactttgccgccgcagcggggcgcttgatcattgatggcatcgaagcc
ctgcgttcggccacctggagcttcgaatccttcagcctggagaacgtcgcgcaaaccctg
ctgggcgaaggcaaggacatttccacgccgtaccagcgcatggacgagatcaaccgcatg
ttcgccgaggacaagcccgccctggcgcgctacaacctcaaggactgcgagctggtcacg
cggattttcgagaagaccgaactgctcaagttcctgctggagcgcgctagcgtcaccggc
ttgccggccgaccgcaacggcggctccgtcgccgcgttcacccatttgtacatgccgttg
atgcatcgccagggcttcgtcgcgccgaacctgggcgacaaaccgccccaggccagcccc
ggcggatttgtcatggactcacgccctgggctttacgaatcggtgttggtgctcgactac
aaaagcctctacccgtcgatcatccgcagtttcctgatcgacccggtgggtctcatcgaa
ggcctcaagtaccccgacgacagtgactcggtagaaggctttcgcggcgcacggttttcc
cgcacccggcattgtctgccgtccattgtcgagcgggtttccgaaggccgcgaggaggcc
aagcgcgaacacaacgcgccgctgtcccaggccctgaaaatcatcatgaacgccttctac
ggcgtactcggctccagcggctgccgcttcttcgatacacgcttggcctcgtcgatcacg
atgcgtggccaccagatcatgcgccagacccgcgaactggtcgaagcccaaggttatgag
gtgatctacggcgacaccgactccaccttcgtgtggctcggcagcgcgcattcccaggag
gacgccagccgtatcggcagggccttggtgcagcacgtcaacgattggtggcgcgagcac
ctgctcaccgcgttcggcctgcaaagcgccctggagttgcagtacgaaacccacttcacg
cggttcctcatgccgaccatccgtggcgcggaggagggcagcaagaaacgctatgccggt
ctggtggtgcgcagcgatggcagcgaagacatggtctacaaaggcctggaaaccgtgcgc
agcgactggtcgcccctggcccgtcgattccagcaggaactctaccagcgcatcttccat
cgccagccccaccaggactacatccgcgactacgtacgccgtaccctcagtggcgaattc
gatgaattgctgatctaccgcaagcgcctgcgccgccggctggacgactacgagcgcaac
gtgccaccccatgtgcgcgccgcgcgtctggccgatgagtacaacgaccgcctgaaccgc
ccgcgccagtaccagcgcggtggctggatcagctacgtgatcagcgtcaacggcccggaa
ccgctggaagtgcggcaagcgcccatcgattacgaccactacgtcacccggcaattacag
ccggtggcggatgcgatcctgccgttcgtgaatgacgatttcagcaccctggtgggcggt
cagatgggcctgttttaa

DBGET integrated database retrieval system