KEGG   Pseudomonas azotoformans: AYR47_18610Help
Entry
AYR47_18610       CDS       T04879                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pazo  Pseudomonas azotoformans
Pathway
pazo00010  Glycolysis / Gluconeogenesis
pazo00052  Galactose metabolism
pazo01100  Metabolic pathways
pazo01110  Biosynthesis of secondary metabolites
pazo01120  Microbial metabolism in diverse environments
pazo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pazo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AYR47_18610
   00052 Galactose metabolism
    AYR47_18610
Enzymes [BR:pazo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     AYR47_18610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AMN80198
UniProt: A0A127I076
LinkDB All DBs
Position
complement(3977512..3978660)
Genome map
AA seq 382 aa AA seqDB search
MKHPRYLLSGLAMSMLIASGGTQAAGLTSEHKPFGKTYDGIAVEQYILRNSHGMQATVIT
YGGVLQSLKVPDKHGKVEDVVLGFDDVQGYQSGTAFFGATIGRFGNRLAGGAFELDGKRY
QVPLNDGPNSLHGGAQGFDKHVWKATPVKAKDSVGVTLTYLSKDGEMGFPGNLKTEVTYR
LNDNNELHIDYKATTDKPTVLNLTNHSYFNLAGAGNGDILKQVATLHASHYTPVNATLIP
TGELAPVMGTPMDFLKPTPIGQHIKEDHPQLKFAEPKQGGFDFNWALDNKGDVKQLAAEV
HDPESGRRLQLFTTEPGVQFYTSNFLDGSVKGKAGKTYQHWSGFTLETQHFPDAPNQPAF
ASTRLNPGQTYTQNTVFKFTTD
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaccctcgatacctgctgtcgggcctggcgatgtccatgctgatcgccagcggc
ggcacccaggccgcaggcctcaccagcgaacacaaacctttcggtaaaacctacgacggc
atcgccgtcgaacagtacatcctgcgcaacagccacggcatgcaagccacggtcatcacc
tacggcggcgtgttgcaatcgctcaaggtgccggacaaacacggcaaggtcgaggacgtg
gtgctgggcttcgacgacgtgcagggctatcaaagcggcaccgcatttttcggcgcgacc
atcgggcgcttcggcaatcgcctggccggtggcgcttttgagctcgacggcaagcgctac
caggtgccgctcaacgacggccccaattcgctgcatggcggcgcccagggcttcgacaag
cacgtatggaaagccacgcccgtcaaggccaaggactcggtgggcgtgaccctcacctac
ctgtccaaggacggtgaaatgggcttccccggcaacctgaagaccgaggtcacctaccgc
ctcaacgacaacaacgaactgcacatcgactacaaggccaccaccgacaaacccacggtg
ctcaacctcaccaaccacagctacttcaacctggccggcgcgggcaatggcgacatcctc
aagcaggttgccacgttgcacgccagccattacacgccggtgaatgccaccctgatccct
accggcgaactggcacccgtcatgggcacgccgatggacttcctgaaaccgacacccatc
ggccagcacatcaaggaggatcacccgcagctcaagtttgccgagccgaaacagggtggg
tttgacttcaactgggcgctggataacaaaggtgatgtgaagcagcttgcggccgaggtg
catgatcctgagtcggggcggcgcttgcagctgtttaccaccgaacctggggtgcagttt
tataccagcaacttcctggatgggtcggtgaagggcaaggctgggaagacctatcagcac
tggagcgggtttacgctggagacccagcatttcccggatgcgcctaaccagccggcgttt
gcctctacgcgcctgaacccaggtcagacctatacccagaacaccgtcttcaaattcacc
accgactga

DBGET integrated database retrieval system