KEGG   Pseudomonas azotoformans: AYR47_19205Help
Entry
AYR47_19205       CDS       T04879                                 

Definition
(GenBank) non-ribosomal peptide synthetase
Organism
pazo  Pseudomonas azotoformans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Condensation AMP-binding PP-binding AMP-binding_C Thioesterase AATase DUF2974
Motif
Other DBs
NCBI-ProteinID: AMN80307
UniProt: A0A127I0P8
LinkDB All DBs
Position
4105518..4121789
Genome map
AA seq 5423 aa AA seqDB search
MNAEDSLKLARRFIGLPLEKRQLFLQALQKEGVDFSRFPIPAGVEAEDRQALSYAQQRMW
FLWQLDPASGAYNLPGAVRLKGTLNLEAMEQAFASLVARHETLRTVFQQQADERLLQVAT
ATPLAVEQLDLSHLSPAEREQAVNDSATRQSLLPFDLESGPLLRVQLLTLDTQEHVLLLT
LHHIVSDGWSMNVLIEEFIRCYDAHERNETPQLPALPIQYSDYALWQRRWLEAGEQARQL
EYWQARLGDEHPVLELPTDRPRPAMPSYQGTRHNFAIEPTLAAQLRSCAQKHNVTLFMLL
LGAFNVLLHRYTGQVDIRVGVPIANRNRTEVEGLIGFFVNTQVLRTELTGQTLVTELLQS
IKEHALGAQAHQELPFERLVEALKVERSLSHTPLFQVMYNHQPVVADIAGVSTASGLELA
LVEWQGRTTQFDLTLDTYEKSGTLHAALTYANDLFDAASIERMAGHWIRLLQAMVADGAQ
RIGELPMLDADEQQVLVHSWNQTAEAYPIERGIHHLIEDQVQATPDAPALVFGATTLTYA
QLDARANQLAHALREKGVGPDVLVGICVERSIEMVVGLLAILKAGGAYVPLDPEYPQERL
AYMIEDSGIRLLLSQHSLLPLLPVEGIQVIALDQPANWLDGYSTDSANVTLHALNLAYVI
YTSGSTGKPKGAGNSHRALVNRLCWMQQSYGLDASDAVLQKTPFSFDVSVWEFFWPLMTG
ARLVVAAPGEHREPARLIETIVQHGITTLHFVPSMLQAFIHESGVQACTSLRRIVCSGEA
LPLDAQLQVFAKLPQAGLFNLYGPTEAAIDVTHWTCVDEGADSVPIGRPIANLGTYVLDA
QLNPVPAGVSGELYLGGTGLARSYHRRPALTAERFVPSPFGDGTRLYRTGDRVRQRANGV
IEYLGRLDHQVKLRGLRIELGEIETRLMQHPSVREAVVLVQGGKQLVAYLVLEDQAPVDL
KAWLLSSLPEYMVPTHIMYLAKLPVTANGKLDRKALPVPDAAPQQAYVAPENDLQKTLAT
IWSDVLGVEQIGLEDNFFELGGDSIISIQVVSRARQAGIRLSPRDLFQYQSVRTLALVAT
REQAAIIDQGPVTGEVILTPVQQSFFEQAIPVRQHWNQSLLLTPRETLEPARLEAALTQL
INHHDALRLRFVQQADGWRQTHAEPVTTAEVWQTQVADDAELAALCDEAQRSLDLEQGPL
LRAALVAMADGSQRLLLVVHHLAVDGVSWRILLEDLQQVYRNAALPAKTSAYQLWAQQLQ
AHALTLDEQLPYWQAQTTSVDLPCDNPQGGLQNRLGSKVEIRLSSEHTRQLLQDAPAAYR
TQVNDLLLTALARVISRWSEQPAALIQLEGHGREDLFDTVDLSRTVGWFTSLFPVRLQAD
GELSAAIKSVKEQLRAVPHKGVSYGLLRYLGTPDAREALSNLATPRVTFNYLGQFDRQFN
ESALFVPATQGSGQAQDPEAPLANWLTVEGQVYGGELALQWGFSREMFDVATVQRLADDY
VAELKALIEHCCDTPVGQVTPSDFPLARLTQSQLDALPIAGPAIADVYPLSPMQQGMLFH
TLYEPEAEAYINQLRLDIDGLDLLAFGRAWQAALDRHDILRSSFHWLGLESAHQVIQRQV
DVQLQVIEDIEADFDALAAAERGKGFALNAAPLFRLMLVRGAGTAWHLIFTSHHILMDGW
SNAQLLGEVIAHYAGQQVPAPQGQFRDYLGWLQQQASGEAFWKTSLAPLQTPTLLAQALR
VPTDGKGMADHHVVLEGDFTQALGEFARRQKVTLNTVLQGAWSLLLQRYTGQDCVAFGAT
VAGRSAPLPGIEQQLGLFINTLPIVSTASPVQSVAGWLSELQALNLSLRDHEHVPLYDIQ
GWAGQQGSALFDTLLVFENFPVAEALKQGAPAGLVFGRLHNHEQTHYPLTLGIELGASLR
LEFGYDQARFSAQQVARLSGNLQHLLVQMLTDAQVSLGNLRLLDDVAQRDMLALSQSPGA
AQNDLRVHERIAAQAAATPEALAVQAGDARLSYAQLNAHANRLAHRLLALGVGPGQRVGL
AARRGPQLIVSLLAVLKSGAAYVPLDPSYPVDRLTYMLSDSRLDLLLSEVGLLADLTLPQ
GLARVDFTASGTELADYPSTNPLNHTSAADLAYVIYTSGSTGQPKGVAIDHAALGQFCDS
AEAYSRLSAADRVLQFATFSFDGFVEQCYPPLCVGAALIMRGDELWDAGQLAREIVEQGV
TLADLPAAYWYLLAKECAVDSRSLGNLRQVHVGGEAMSVEGLRAWHAAGLGDVRLVNTYG
PTEATVVSSVHDCQLADASDAFGVPIGRAIQGRSLYVLDSGFDLLATEGVGELCIGAEHG
LAQRYFDRPALTAERFLPDPFSAVPGSRLYRSGDLARYNAAGALEYVGRIDHQVKIRGFR
VEMGEIEASLQAVPQLREAAVIAQSSATGTQLVAYVVPVNGQSLDLPALAATLRQSLPDY
MVPGHWVTLDALPLNNNGKLDRRALPAPDLSQARQAYAAPQNALQMQLATIWQAVLQVEQ
VGLHDHFFERGGHSLLATQVVSRVRHDLKLEVPLRTLFEQPTLEAFAAACAGLQATTALP
LVAVTRDQPLALSFAQERQWFLWQLDPTSAAYHVPSALRLKGLVDKAALQKAFDALVVRH
ESLRTHFHQDAERTVQVISACTRIELVSADTDEASLKAEVEARIAQPFDLRQGPLMRVSL
LRLAPDEHVLVIVQHHIISDGWSMQVMVDELVQLYTAYSQGQTLQLPAMSIQYADYAQWQ
RTWMEAGEKARQLDYWCKVLGGEQPVLELPFDHQRPAVPTHRGARLNIALPATLVDSLKA
LAQREGVTLFMVLLASYQALLHRYSGQQDIRVGVPIANRNRVETERLIGFFVNTQVLKAD
VDGQTTVRQLLTQVKQRALEAQAHQDLPFEQLVEALQPERSLSLSPLFQVAFNHHISQAG
EHLQRLAQLDMSPVSWDETAAHFDLILDIEESGNQLGASLSYATDLFAPATIARMAGHWQ
NLLQAMVADQQQSISQLNLLGQDEQQHILQLWNQTDAGFSAKRLVHELVADRARENPDAV
AVKFDARTLSYGELDRQANRLAHALIARGVGPEVRVAIAMPRSAEIMVAFLAVMKAGGVY
VPLDVEYPRDRLLYMMQDSRAKLLLTHSSALQQLPIPEGLGTLAIDRTEGWADYRDTAPD
VKLDGDNLAYVIYTSGSTGMPKGVAVSHGPLVAHIIATGERYETSPSDCELHFMSFAFDG
SHEGWMHPLINGASVLIRDDSLWLPEYTYEQMHRHNVTMAVFPPVYLQQLAEHAERDGNP
PKVRVYCFGGDAVAQASYDLAWRALKPTYLFNGYGPTETVVTPLLWKARQGDPCGAVYAP
IGTLLGNRSGYVLDSQLNLQPVGVAGELYLGGEGVARGYLERPALTAERFVPDPFGKPGS
RVYRSGDLTRGRPDGVVDYLGRVDHQVKIRGFRIELGEIEARLREQDNVGETVVVAQEGP
TGKQLVAYVVPANAGPANETEFRETLRRALKTRLPDYMVPTYFMFLAQMPLTPNGKLDRK
GLPQPDASLLQQAYVAPQSELEQQLAAIWADVLRLPQVGLNDNFFELGGDSIISIQVVSR
ARQAGIRFTPKDLFQHQTVQSLAGVARQGVEGLTISQAALSGETLLLPIQQAFFADEIAE
RHHWNQSVVLQPHEHLDAATLTQALQALLVHHDALRSRFVEGAQGWQGLFRAAEHHQADT
VLWQSTLHGVEALTALAEEAQRSLDLDQGPLMRAVLVQLDDGSQRLLLVIHHLVVDGVSW
RILLEDLQTAYRQLAAGTPVALPAKTSSTRDWAQRLQQYAQGEALTQELAWWQAQLHGAE
ADLPSAKPGASLSNRHIGSATTHLDGSHTRRLLQDAPAAYRTQINDLLLTALARVIGRWT
GHDSTLIRLEGHGREDLFEDIDLTRTVGWFTSLYPVKLTPASTLADSLKGIKEQLRAIPD
KGIGFGALRYLGQPDVRDALARLPQPRITFNYLGQFDTSFDGNEQQGLFAPSGDAAGSDQ
SPDASLGNWLEINGQVYGGELNLNWSFSQQMFDSASIQQLADDYAQELKALIGHCCQPEH
SGATPSDFPLARLSQVQLDGLALPLSQVDDIYPLSPMQQGMLFQSLFGQGSGDYINQMRV
DVQGLDVARFQAAWQVALGHHDILRTGFLWQTELEQPLQVVYKAAQVPLVEHDWQQREDL
GEALDALAQTLRADGFVLEQAPLLSLVVVRTSIDSHHLIYTNHHILMDGWSASQLFGEVL
QQYAGESLRAPNGRYRDYIGWLQAQDPLTSETFWKAQLAGLQTPTRLSRGLAREQDVSEV
NGIHRLTLEQTVTEQLKAFAQRHKVTLNTLVQSAWLLLLQRHTGLDTVAFGATVAGRPAE
LPGIEQQVGLFINTLPVVATPSPQLSVNDWLQQVQAQNLRLREQEHTPLFEIQRWAGLGG
EALFDSILVFENYPVSEALEQGSPTGLRFGTMDSLEQTHYPLTVLLAMGDRLAMEFNYDH
AAFETQDVVNLSAHFQQLLLALTLPQVERLADLPSLPAAQHQLIVEDWNATTRDYPLHRG
VHQMIEDQVALAPDAPALVFGAQHLSYAELNRRANRLAHRLIAAGVGPDVLVGLAVERSI
EMVVGLLAVLKAGGAYVPLDPEYPRERLAYMLDDSGVKLLLTQAHLLEQLPIPEGLSSLV
LGETGFEGYSDANPGIILDGENLAYVIYTSGSTGQPKGAGNRHSALANRLHWMQEAYSLD
AGDSVLQKTPFSFDVSVWEFFWPLMTGSRLVVAAPGDHRDPAKLIDLINQEQITTLHFVP
SMLQAFLQDSKVSTCASLQRIVCSGEALPVDAQQQVFAKLPHASLYNLYGPTEAAIDVTH
WTCVEEGCDAVPIGKPIANLGCYILDSNFEPVPVGVLGELYLGGIGLARGYHRRPALTAE
RFIAHPFVSGERLYRTGDLARYRDDGVIEYAGRIDHQVKLRGLRIELGEIEARLLEHEWV
REAAVLAVDGKFLVGYLVLQNAGDDWRDVLGAHLAQQLPDYMVPAQWVVLDQMPLSPNGK
LDRKALPRPDAVQHAQAYLAPQSPLEKQLAAIWRDVLGVEKVGLRDNFFELGGHSLLILM
LKERIKNACGTNLSVTQLMLNPTVQGQVDCLLGSARRSLIVPLNSVESGTPLFLFHPSYG
SVHCYKAVALALREQRPVLGVICRALTEEGGTVPAWATMVEDYTEQLLVAHPQGAFRLAG
WSLGGNLALDVAYRLEQAGREVECVGLVDTPPPHDVTAFWKEDDNADDRHLSDVEQRAEL
LGVMFPAQALQIQTAWQEAQACEQDQVRQWARLDAWAEHTLGEAYLTLKRELLEGSEAQV
SWDVKRELDQRLQEARYSAITAPVLCWWAAQSKGGQHRELIESSLRAVLGQMAIEHSVVI
DTTHERIVDNAEFVSSFLDVMGR
NT seq 16272 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgaagactccttgaaacttgctcgccggtttatcgggttgcccctggaaaaa
cgccaattgttcctgcaggccttgcagaaagaaggggtggatttttcccggtttccgatt
ccggcaggggtggaggcggaggatcgccaggcgctgtcctacgcgcagcagcgcatgtgg
tttctgtggcaattggacccggccagtggcgcctacaacctgccgggcgctgtacgcctc
aaaggcacgttgaacctggaagcgatggagcaagcatttgcgagcctggtcgcgcgccac
gaaaccctgcgcaccgtgttccagcaacaggccgatgagcgcctgttgcaagtggcgact
gcaacgccgttggccgtcgaacaactcgacctgagccacctgtctcctgctgagcgcgaa
caagccgtcaacgactccgcgacccgtcaatcgctgctgccgttcgatctggaaagcggc
ccgttgctgcgcgtgcaattgctcacgctcgacacgcaggaacacgtgttgctgctgacc
ctgcatcacatcgtctccgacggttggtcgatgaacgtgctgatcgaggagttcatccgc
tgctacgacgcccatgagcgcaatgaaacgccgcaactgccggccttgccgatccagtac
agcgactacgccctgtggcaacgccgctggttggaagcgggtgagcaggctcgacaattg
gagtactggcaagcgcgcctgggcgatgagcacccggtgctggaactgcccacggatcgc
ccacgtccggccatgccgagttaccagggcacgcgccataatttcgcgatcgaacccacg
ctggccgcacaactgcgtagctgcgcacaaaagcacaacgttaccttgttcatgctcttg
ctcggtgcgttcaacgtgctgctgcatcgctataccgggcaggtcgatatccgtgtcggc
gtgccaatcgccaaccgcaaccgtactgaagttgaagggctgatcggctttttcgtcaat
acccaagtgctacgcaccgagctgaccgggcaaacccttgtcaccgaattactgcaaagc
atcaaggagcacgcactgggcgcccaggcccatcaggaattgccgttcgagcgcctggtg
gaagccctcaaggtagagcgcagcctcagccatacgccgttgttccaggtcatgtacaac
caccagccggtggtggccgacattgcgggcgtcagcacggcctccggcctggaactggcg
ctggtggagtggcaaggccgcaccactcagttcgacctgaccctcgacacctatgaaaaa
tccggcaccctgcacgccgcgttgacctacgccaatgacctgttcgacgcggcgtccatc
gagcgcatggctgggcattggatccgtctgttgcaggccatggtggccgacggtgcgcag
cgcatcggtgagttgccgatgctggatgcggatgagcagcaagtgctggtccacagctgg
aaccagaccgccgaggcgtacccgatcgagcgcggcatccatcacctgatcgaagaccag
gtacaggccacgcccgacgcgccagcgctggtgttcggcgccacaacgctgacctatgcc
cagcttgatgctcgcgccaaccagctggcccatgccttgcgcgagaagggcgtaggtccg
gacgttctggtcgggatctgcgttgagcgctcgattgaaatggtggtcggcctgctggct
atcctcaaggcaggtggcgcctacgtcccgttggaccctgagtatccccaggaacgcctg
gcctacatgatcgaagacagcggcattcggttgttgctcagtcaacacagtctgttgccg
ttgttgcctgtcgaaggcatccaggtgattgccctggaccagcccgccaactggctcgat
ggctacagcaccgactcggcaaacgtcacccttcacgcgctgaacctggcctacgtgatc
tacacctccggctccaccggcaagcccaagggcgccggcaacagccatcgtgcgctggtc
aaccgcctgtgctggatgcagcaatcctatggcctggacgccagcgatgcggtcctgcaa
aaaaccccgttcagcttcgatgtgtcggtgtgggagttcttctggccgctgatgaccggc
gcacgcctggtggtagcagcgcccggcgagcatcgcgaaccggcacgcctgatcgagacg
attgtgcagcacggcatcaccacgttgcactttgtgccgtcgatgctccaggcgtttatc
catgagtcgggcgtgcaggcttgcacgagcctgcgccgcatcgtctgcagtggcgaagcc
ttgccgctggatgcgcaattgcaagtgtttgccaagttgccccaagccggtctgttcaac
ctgtatggcccaaccgaagccgccatcgacgtcacccactggacctgcgtcgacgaaggc
gccgacagcgtgcccatcggccgccccatcgctaacctcggcacctacgtgctcgatgcc
cagctcaacccggttcccgctggcgtcagcggcgagctgtacctgggcggcactggcctg
gctcgtagttatcatcgacgtccggcacttactgccgaacgttttgtgcccagtcctttc
ggtgacggcacgcgtctgtaccgcacgggcgaccgcgtgcgtcagcgcgccaatggcgtc
atcgaatacctcggccgcctcgaccatcaggtcaagctgcgtggcctacgtatcgagctg
ggtgaaatcgagacgcgcctgatgcaacacccctcggtgcgcgaggcggtggtgctggtg
cagggcggcaagcagttggtggcctacctggtgctggaagaccaggcgccggtcgatctc
aaggcctggctgctgagcagcctgccggagtacatggtacccactcatataatgtacttg
gccaagctgccggtgaccgccaacggcaagctcgaccgcaaggccttgccggtgccggat
gctgcaccacaacaggcttatgtcgcaccggaaaacgacctgcaaaaaacactggcgact
atctggagtgacgtactgggcgtcgagcagatcggcctggaagacaactttttcgagctg
ggcggcgattcgatcatctccatccaggtggtcagccgtgcgcgccaggcggggattcgc
ctcagtccaagggacctgttccagtaccagagtgtgcgcaccctggcgctggtcgcgacc
cgcgagcaagcggctatcatcgaccaagggccagtcaccggcgaagtcattctcacgccc
gtgcaacagagctttttcgagcaggcgattccagtgcgtcagcattggaaccagtcgctg
ctgctgacgccacgggaaaccctggaacctgcacggcttgaagcggctttgacccaactg
atcaaccaccacgacgccctgcgcctgcggtttgtgcaacaggctgacgggtggcggcaa
acccatgccgagcccgtgacaacggctgaagtgtggcaaacccaagtcgctgacgacgct
gagttggccgcactctgcgacgaagcccagcgcagtcttgatcttgaacagggcccgttg
ttgcgtgctgccctggtggcgatggccgacggctcccaacgcttgctgttggtggtgcat
cacctggcggtagacggcgtatcgtggcgcatcctgctcgaagacctgcaacaggtctac
cgcaatgccgcattgccggccaagaccagcgcctatcaactgtgggcgcagcaattgcag
gcccatgcgttgacgctggacgagcaactgccgtactggcaggcccagaccacgagcgtc
gatctgccgtgcgataacccccagggcggcctgcaaaaccgcctgggcagcaaagtcgaa
attcgcctgagtagcgaacatacccgtcaactgctgcaagacgcgccagcggcctaccgc
acccaggtcaacgacctgctgctgactgccctggcgcgtgtcatcagccgctggagcgaa
cagcccgccgcgctgatccaactggaaggccatggacgcgaagacctgtttgacacggtt
gacctgagccgcactgtcggctggttcaccagcctgttcccagtacgcctgcaagccgat
ggcgagctgtcggctgcaatcaaatcggtaaaagagcaactgcgcgccgtaccgcacaag
ggcgtcagctacggcctgctgcgctatctcgggacgcctgacgcccgcgaagccctgtcg
aacctggctacgccgcgcgtcaccttcaactacctgggccagttcgaccgccagttcaac
gagtcggcgctgttcgttccggctacccaaggcagtgggcaggcccaggatcccgaggcg
ccgctggctaactggctgacggtggaagggcaggtgtatggcggtgaactggcgctgcag
tggggtttcagccgtgagatgttcgatgtcgcgacggtccagcgcctggcggatgactac
gtggccgaactcaaggccttgatcgagcattgctgcgacacgccggtggggcaagtcacc
ccttctgattttccgttggcacgcctgacccagtcgcagttggacgccttgcccatcgcc
gggccggcgattgccgatgtctacccgctgtcgccgatgcagcagggtatgttgttccat
acgctgtacgagcccgaggctgaggcctacatcaaccagttgcgcctggacatcgatggt
ctggacttgctggcattcggccgtgcctggcaggccgcgctggaccgccatgacatcctg
cgcagcagcttccactggctcggtctggaaagcgcccaccaggtgatccaacgccaggtg
gatgtgcagttgcaagtcatcgaagacatcgaagccgatttcgatgcgctcgccgctgcc
gagcgcgggaaaggctttgcgctgaatgcggcgccgctgtttcgcctgatgctggtgcga
ggtgccggcactgcctggcatctgatcttcaccagccaccacatcctcatggacggctgg
agtaacgcccagttgctcggcgaagtcatcgctcactacgccgggcaacaggtgccggcg
ccgcaggggcagttccgtgattacctggggtggttgcagcagcaagcctcaggtgaagcg
ttctggaaaaccagcctggcaccgttgcaaacgccgaccttgctggcccaggcgctgcgt
gtaccgaccgacggcaagggaatggccgatcatcatgtggtgctggagggcgatttcacg
caggccctcggtgagtttgcccgccgccagaaagtcaccctcaacactgtgctgcaaggc
gcttggagcctgttgttgcaacgctataccgggcaagactgcgtggcctttggcgccact
gtcgcaggacgctcggcgccattgccggggattgagcaacaactgggcctgttcatcaac
acgctgcccatcgtcagcacagcctcgcccgtgcagtcggtggccggctggttgagcgaa
ctgcaagcgctcaacctgagcctgcgcgaccacgaacatgtgccgctgtatgacatccag
ggctgggcggggcagcagggcagtgcgctgttcgacaccttgctggtattcgaaaacttc
ccggtggccgaagccttgaaacaaggcgcgccagccggcctggtgttcggccgcctgcac
aaccatgaacagacccactatccgctgaccctggggatcgaactgggcgccagcctgcgc
ctggagtttggctatgaccaagcgcgtttcagcgcacagcaggtcgctcggctgagtggc
aacctgcaacacctgctggttcagatgctcacggatgcccaggtatcgcttggcaatctg
cgtctgctcgacgacgttgcccagcgcgacatgctcgccctcagccagtcgccgggtgcc
gcacaaaatgacctgcgcgtgcacgaacgtatcgccgcccaggccgccgccacgccggag
gcgctggcggtacaagctggcgatgcacgcttgagctatgcacagctcaatgctcacgcc
aaccgtctggcccatcgcctgttggcgctgggcgttgggcctggccaacgcgtcggcctg
gccgctcgacgcggtccgcaattgattgtcagcttgctcgccgtgctcaaaagcggcgcc
gcctatgtgccgctcgacccgagctacccggtggatcgcctgacctacatgctgtcggac
agccgcctcgatctgctgctcagcgaggtcggtttgctcgcggacctgacactgcctcaa
gggctggcgcgtgtggacttcaccgcctccggcacagagttggcagactacccgtcgacc
aatccactcaatcacacaagcgccgctgaccttgcgtatgtgatctacacctccggctcc
actggccagcccaagggtgtggccatcgatcatgccgccctcggtcaattctgcgacagc
gcagaggcctacagccgcttgagtgctgcggaccgcgtgctgcaattcgcgaccttcagc
ttcgacggcttcgtcgagcaatgctacccacccctgtgtgtcggcgctgcgttgatcatg
cgcggcgatgaactgtgggacgccgggcaattggctcgggaaatcgtcgagcaaggcgtg
accctggcggatttgccagccgcttactggtacttgctcgccaaggaatgtgctgtcgac
tcacgcagcctgggcaacctgcgccaggtgcatgtgggcggcgaggcaatgtcggtggaa
gggctgcgcgcctggcacgccgctggcctgggcgacgtgcgcctggtcaatacctacggg
cctaccgaggcgaccgtggtgtccagcgtgcacgactgccagttagcggacgccagcgat
gcgtttggcgtgccgattggccgggcgatccaggggcgctccttgtatgtgctggacagc
ggtttcgacctgttggcaacagagggcgttggcgaattgtgcatcggcgccgaacacggc
ttggcccagcgctatttcgaccgtccggcgctgactgctgaacgcttcctgccggaccca
ttttccgccgtgccgggttcgcgtctctaccgcagcggcgacctggcccgttacaacgcg
gcgggtgcgcttgagtacgtcggacgcatcgatcatcaagtgaagatccgtggtttccgc
gtggagatgggcgaaatcgaagccagcctgcaagccgtgccgcagttgcgcgaagccgcc
gtcatcgcgcagtcaagtgcgacgggcacgcaattggtggcgtacgtggtgcccgtcaat
gggcagtccctggacttgcccgcattggcagccaccttgcgccagtccctgccggactac
atggtgccggggcattgggtcaccctcgatgcgctgccattgaacaacaacggcaagctc
gaccgtcgcgcgctgccggcgcccgacctgagtcaagcgcgccaggcctatgcagccccg
caaaatgccctgcaaatgcaactggccaccatctggcaagccgtgttgcaggtggagcag
gtggggctccatgatcacttcttcgagcgtggcggccattcattgctcgccacccaagtg
gtctcgcgggtgcgccatgacctcaagctggaagtgcctttgcgcacgctgttcgaacag
ccgacgctggaagcgttcgcagctgcttgcgcagggttgcaggccaccacggcactgccg
cttgtggcggtgacacgtgaccagccgctggcgctgtcgtttgcccaggagcgtcaatgg
ttcctctggcaactggacccgaccagtgcggcttaccatgttcccagcgccctgcgcctc
aaggggctagtggacaaggctgcgttgcagaaggcgtttgatgccctggtcgtgcgccac
gaaagcctgcgcacccacttccaccaggatgcggagcgcacggtgcaagtcatcagtgcg
tgtacacgcatcgaactggtgtcggccgacactgacgaagcgagccttaaagccgaagtt
gaagcgcgtatcgctcagccatttgacctgcgccagggcccattgatgcgggtcagcctg
ttgcgcctggccccggacgagcatgtgctggtgatcgtgcagcatcacattatttccgat
ggctggtcgatgcaggtcatggttgacgaactggtgcagctttacaccgcctacagccaa
gggcagacgttgcaattaccggccatgtcgatccagtacgccgactatgcgcagtggcag
cgcacatggatggaggcgggggagaaggcccgccagcttgactactggtgcaaggtgctc
ggcggcgagcaaccggtgctggagttgccgttcgaccaccagcgtccggcagtgccgacc
catcgcggcgcacgcctgaacattgcgttgccggccacgctggtcgacagcctcaaggcc
ctggcccagcgcgaaggtgtgaccctgttcatggtgctactggcttcgtaccaggcgttg
ttgcatcgctacagcggccagcaggacattcgcgtcggggtgccgattgccaaccgtaac
cgcgttgaaaccgagcggctgatcggcttcttcgtcaatacccaggtgctcaaggctgat
gtcgacgggcagaccaccgttcgccagctactgacccaggtcaaacaacgcgcgctggaa
gcccaggcgcatcaggacctgccgttcgagcaactggtcgaggccctgcaacccgagcgc
agcctgagcttgagtcccttgttccaggttgcgttcaaccaccacatcagccaggctggc
gagcatttgcagcgcctggcgcagctggacatgagcccggtgagctgggatgaaacagcc
gcgcatttcgatctgatcctggatatcgaggagtccgggaaccagctcggcgcatcgctg
agttatgccaccgatctgtttgccccggcgaccatcgcgcgcatggccggccattggcag
aacctgttgcaggcgatggttgctgatcaacaacagtccatcagccaattgaacctgctg
ggccaggatgagcagcagcacattctgcaactgtggaaccagactgatgccggcttctcg
gccaagcgtcttgtgcatgagttggtggctgaccgcgccagggaaaaccccgatgcggtc
gccgtgaaattcgacgcgcgaaccctgagctatggcgagctggaccgccaggccaaccgc
ctggcccatgcgctgatcgcccgtggcgtcggtccggaagtgcgggtggccatcgccatg
ccgcgcagtgccgaaatcatggtggcgttcctggcggtgatgaaagccggtggcgtgtat
gtgccgctggacgtggaatacccgcgtgaccgcctgctgtacatgatgcaggacagccgt
gcgaagctgttgctgacccatagcagcgcgttgcagcaactgccgattcccgaaggactg
ggcacattggcgattgatcgcaccgagggctgggcggattaccgcgacactgcaccggac
gtgaagctggacggcgataacctggcttacgtgatctacacctcgggttcgaccggtatg
cctaagggcgtggcggtgtcccacggtccgttggtggcgcacatcatcgccactggcgag
cgttatgaaaccagcccgtctgactgcgaactgcacttcatgtcgttcgccttcgacggc
tcccacgaaggctggatgcacccgttgatcaacggcgccagcgtgttgatccgtgacgac
agcctgtggctgccggaatacacctacgaacagatgcaccgtcacaacgtgaccatggcg
gtgttcccgccggtttacctgcaacagttggccgagcatgccgagcgtgacggcaaccca
ccgaaggtgcgtgtgtactgctttggcggtgacgcggtcgcccaggccagctacgacctg
gcgtggcgcgcgctgaaaccgacctacctgttcaacggctacggcccgaccgaaaccgtg
gtcacgccattgctgtggaaggcacgccagggcgatccgtgcggcgcggtttatgcccca
atcggcaccctgttgggcaaccgcagcggctacgtactcgactcgcaactcaatcttcaa
cctgtcggcgtggccggcgagttgtatctgggcggcgagggcgtggctcgtgggtatctt
gagcgtccggcactgacggcagaacgctttgtaccggacccgttcggcaagccgggtagc
cgcgtgtatcgcagcggcgacctgacccgtggccgcccggatggtgtggtggattacctc
ggtcgtgtcgaccaccaggtaaaaatccgcggtttccgtatcgaactgggcgagatcgaa
gcgcgcctgcgcgaacaggacaacgtcggcgaaaccgtggtggtcgcccaggaaggtccg
accggtaaacaactggtggcctacgtggtgccggccaatgctggccctgccaacgaaacc
gagttccgcgaaaccctgcgccgcgccttgaaaacccgtctgcccgactacatggtgccg
acgtacttcatgttcctggcgcaaatgccgctgacgcccaatggcaagctcgaccgcaaa
ggcttgccgcaaccggacgcaagcctgttgcaacaagcctacgtggcgccgcaaagcgag
ctggaacaacagctcgccgccatctgggccgacgtgctgcgcttgccgcaggtgggcttg
aacgacaacttcttcgagctgggcggcgattcgatcatctcgatccaggtggtcagccgt
gcacggcaagcgggcatccggttcacgcccaaggacctgttccagcaccagaccgtacag
agcctggccggcgtcgcgcgccagggtgtcgaaggcttgaccatcagccaggccgccttg
agtggcgagacgttgctgttgccgatccagcaagccttcttcgccgatgagattgccgaa
cgtcaccactggaaccaatcggtggtgctgcagccccacgaacacctcgatgccgcgaca
ttgacccaggccttgcaagcgttgctggtgcaccacgatgcgttgcgctcgcggtttgtt
gaaggcgcgcagggctggcagggtctgttccgtgcggccgagcaccatcaggccgatact
gtgttgtggcaaagcacgctgcacggtgttgaagcactcacggcattggccgaggaggcg
caacgcagccttgatctcgaccagggcccgctgatgcgcgccgtgctggttcaattggac
gatggttcgcagcgcttgctgctggttatccatcacttggtcgtcgatggcgtgtcgtgg
cggattctcttggaggatttgcaaacggcctaccgccaactcgccgcaggcaccccagtg
gcattgcctgccaagaccagttccacccgcgactgggcgcaacgtcttcagcaatacgcc
caaggcgaggcactgacccaggagctggcgtggtggcaagcacaattgcacggcgccgag
gccgacctgccaagcgccaagccaggagcgagcctgagcaatcgccatatcggcagcgca
accacgcacctggacggcagccatacccgtcgcctgctgcaggacgccccggcagcctat
cgcactcaaatcaacgacctgttactgacggcgctggcgcgggtgatcgggcgctggacc
ggccacgattcgaccctgatccgcttggaagggcatggccgcgaagacctgttcgaggac
atcgacctgacacgtacggtcggttggttcaccagcctctacccggtaaaactcaccccg
gcttcgaccctggcggattcattgaagggcatcaaggagcagctgcgcgcgattcccgac
aagggcatcggttttggtgccctgcgttacctgggccagcccgatgtgcgtgacgcattg
gcacgcctgccgcaaccgcgcatcaccttcaactacctaggccagttcgataccagtttt
gatggcaatgaacagcagggcttgtttgcgccttctggtgatgccgccggcagcgaccag
agcccggatgcatcgctgggcaactggctggaaatcaacggccaggtgtatggcggtgag
ctgaacctgaactggagcttcagccagcagatgttcgattcggcgagcatccagcaactg
gcggatgactacgcgcaagagctcaaggcgctgatcgggcattgctgccagcctgaacac
tccggcgccaccccatcggacttcccactggcccgcttgagccaggttcagttggatggc
ctggccttgccgttgagccaggtcgacgatatttacccgctgtcgccgatgcagcagggc
atgctgttccaatccctgttcggccagggctcgggcgactacatcaaccagatgcgcgtt
gacgtgcaagggctggatgtggcgcgtttccaggcggcctggcaggtcgccctggggcac
cacgacatcctgcgcaccgggttcctctggcagaccgagctggagcagccgttgcaggtg
gtctacaaggcggcccaggtgcctttggtcgagcacgattggcagcagcgtgaagacctc
ggtgaagcgctcgatgctttggcgcaaacccttcgtgcagatggcttcgtgcttgagcag
gcgcctttgctgagcctggtcgtggtgcgtaccagcatcgacagccatcaccttatttac
accaaccaccacattctgatggatggctggagtgcttcgcagctgtttggcgaggtgctg
caacaatacgccggcgaatcgctacgcgcgccgaacggacgctatcgcgattacatcggc
tggttgcaggcacaggatccgctcaccagcgagaccttctggaaagcccagctcgcgggc
ttgcagacgccaacgcgactgtcccgtgggctcgcccgcgaacaggacgtgtccgaggtc
aatggcattcaccggctgaccctggagcagacggtaaccgaacaactcaaagcgtttgcc
cagcgccacaaggtgacgctcaataccctggtgcaaagcgcctggctgttgctgttgcaa
cgtcataccggcctggacaccgtcgcctttggtgccacggtggcgggacgcccggccgaa
ttgccgggtatcgaacagcaggtgggtttgttcatcaacacgctgccagtggtggccacg
ccgagcccgcagttgagcgtgaatgattggttgcagcaggtgcaggcacaaaacctgcgc
ctgcgtgaacaggagcacacgccgctgttcgagatccagcgctgggcagggctgggcggc
gaggcgttgttcgacagcatcctggtattcgagaactaccctgtgtccgaggctttagag
cagggatccccgacgggcctgcgtttcggcacgatggacagcctggaacagacccactat
ccgctgaccgtactgctggccatgggtgatcgcctggcgatggagttcaactacgatcac
gccgcgttcgaaacgcaggacgtcgttaacctgtcggcgcatttccagcagttgctgctg
gcgttgacgctgccgcaggttgagcgcctggcagacctgccgtcgttgcccgctgctcag
caccagttgattgtcgaggactggaacgcgacaacgcgggattatccattgcaccgtggc
gtgcaccagatgatcgaagaccaggtggccttggcgccagacgcaccggccctggtgttt
ggtgcgcagcacctgagctatgccgagctgaaccgtcgcgccaaccgcctggctcatcga
ttgatcgccgccggcgtagggccggacgtgctggtgggcctggccgtagagcgatccatc
gaaatggtggtgggcctgctggcagtgctcaaggccggtggtgcctatgtgccgctggat
ccggaatacccgcgtgaacgcctggcctatatgctcgatgacagtggcgtgaagctgctg
ttgacccaggcgcatctgctggagcagttgccgatcccggagggtttgagcagcctggtg
ctgggcgaaacagggttcgaaggctatagcgacgccaacccgggcatcatcctggacggc
gagaaccttgcctatgtgatctacacctcaggctccaccggccagcccaaaggcgccggc
aatcgacattcggccctggctaacaggctccactggatgcaagaagcctacagcctggac
gccggcgacagcgtactgcaaaagaccccgttcagcttcgacgtgtcggtgtgggagttc
ttctggccgctgatgaccggctcgcgcctggtggttgcagcgcctggggatcaccgtgat
ccggccaagttgatcgacctgatcaatcaagagcagatcaccacgctgcattttgtgcca
tcgatgctgcaggcgttcctgcaggactcgaaggtgtctacctgcgccagcctgcagcgc
attgtctgcagtggtgaagcgttgccggtggacgctcagcaacaagtgttcgccaagctg
ccgcacgccagtctttacaacctgtacgggccgactgaagccgctatcgacgtgacccac
tggacttgcgtagaggagggctgcgatgcggtgcctatcggtaagccgattgccaacctg
ggctgctacatcctcgacagcaacttcgagccggtaccggtgggtgtactgggcgagttg
tacctgggtggcatcggcctggcccgtggttaccatcgccgcccggcactcaccgccgaa
cgctttattgcgcatccattcgtaagcggcgaacgcctgtaccgcaccggcgacctggcg
cgttaccgcgacgacggcgtgatcgagtacgccgggcgtatcgaccatcaggtcaagttg
cgcggcctacgcatcgagttgggcgaaatcgaagcacgcctgctggaacacgagtgggtg
cgtgaggctgccgtgctggcggtggacggcaagttcctggtgggctacctggtgctgcaa
aacgcgggtgacgattggcgcgatgtgctgggcgcccacctggctcaacagctgccggac
tacatggtgccggcgcagtgggtcgtactcgaccagatgccgttgagccccaatggcaaa
ttggatcgcaaggccttgccaaggcctgatgcggtccagcacgcccaggcttacctggca
ccgcaaagcccgttggagaaacagctggcagcgatctggagggatgtgttgggtgtcgaa
aaagtcggcctgcgcgataatttcttcgaactgggtgggcactctttgttgatattgatg
cttaaggagcgcatcaaaaacgcctgcggcaccaacttgtcggtgacccagttgatgctc
aaccctacggtgcaagggcaagtcgattgcctgctgggcagcgcacgccgttcgctgatt
gtgccgctcaacagcgtggaatcggggacgccgttgttcctgttccatcccagctatggc
tcggtgcattgctacaaggccgtcgccctggcgctcagggaacagcgtccggtgctgggc
gttatctgtcgggcgctgacagaagagggtgggacggtgcctgcctgggccactatggtc
gaggactacaccgagcaattgttggtcgctcatccgcaaggtgcgttccgcctggccggt
tggtcgcttgggggcaacttggcactggacgtggcctatcgcctggagcaggcggggagg
gaggtagagtgcgtcggcctggtcgacacgccgccgccgcatgacgtgacagcattctgg
aaggaagacgataacgccgatgatcgacacttgtccgacgttgagcagcgggctgagttg
ctcggcgtgatgttcccggcccaggccctgcagatccaaacagcctggcaggaggcccaa
gcgtgcgagcaagatcaagtgcggcaatgggcacgactggatgcctgggctgagcacacc
ttgggtgaggcctacctgacgctaaagcgcgaactgctggaaggttccgaggcgcaggtg
tcctgggacgtcaagcgcgaactggatcagcggctgcaagaggcccgatactcggcgatc
actgcaccggtactgtgctggtgggcggcgcagagcaagggtgggcagcaccgcgagctg
atcgagtcgagcctgcgggcagtgctggggcagatggcaatcgagcattcggtcgtgatc
gacactacccatgagcggatcgtggacaacgccgaatttgtcagcagtttcctggatgtg
atgggcagataa

DBGET integrated database retrieval system