KEGG   Pseudomonas azotoformans: AYR47_21150Help
Entry
AYR47_21150       CDS       T04879                                 

Definition
(GenBank) alpha-amylase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
pazo  Pseudomonas azotoformans
Pathway
pazo00500  Starch and sucrose metabolism
pazo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pazo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AYR47_21150
Enzymes [BR:pazo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AYR47_21150
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AYR47_21150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C Mak_N_cap MMPL
Motif
Other DBs
NCBI-ProteinID: AMN80658
UniProt: A0A127I1F4
LinkDB All DBs
Position
4589881..4593243
Genome map
AA seq 1120 aa AA seqDB search
MAKKPNAATFIKDPLWYKDAVIYQVHVKSYFDSNNDGIGDFPGLIAKLDYIADLGVNTIW
LLPFYPSPRRDDGYDIAEYRGVHSDYGTLADAKRFIAEAHKRGLRVITELVINHTSDQHP
WFQRARKAKPGSAARDFYVWSDDDQKYDGTRIIFLDTEKSNWTWDPVAGQYFWHRFYSHQ
PDLNFDNPQVMKAVLSVMRYWLDMGIDGLRLDAIPYLIERDGTNNENLPETHDVLKQIRA
EIDAHYPDRMLLAEANQWPEDTQLYFGDKKGDDGDECHMAFHFPLMPRMYMALAQEDRFP
ITDILRQTPEIPANCQWAIFLRNHDELTLEMVTDKERDYLWNYYAADRRARINLGIRRRL
APLMERDRRRVELLNSLLLSMPGTPTLYYGDEIGMGDNIYLGDRDGVRTPMQWSIDRNGG
FSRADPASLVLPPIMDPQYGYQSVNVETQAQDPHSLLNWTRRMLAVRKQSKAFGRGSLKM
LSPSNRRILAYTREFTGEDGRNEIILCVANVSRSAQAAELDLSAFAGMVPVEMLGGNAFP
PIGQLNFLLTLAPYGFYWFVLAPENQMPSWHVEPAQSMPDFTTLVLKKRMEELLDEPCRA
SLEQTALPAWLPKRRWFAGKDTAIDSVRIAYGVRFGDPQHPVLLSELEVTAGGQVSRYQL
PFGFLGEDQFTSALPQQLALARVRRVRQVGLVTDAFSLEHFIRAVIQGLQAGTVLNTNEG
ELRFAATPHLAKLQLTDESEVRYLSAEQSNSSVVVGESLVLKLIRKVASGVHPELEMSAY
LTAAGYPNISPLLGSMVRHDAQGQDNLLMIAQGYLSNQGDAWSWTQNNLERAIRDELAEA
ISEQEQHYNALGELADFAGLLGQRLGEMHLVLGAKTTNKDFKPEVTTAKDTQAWAKDVGA
QLDRALQLLKLHQSQLNPADQALVSDLLAQKKAIASHVQALAKATAGGLRIRVHGDLHLG
QVLVVKGDAYLIDFEGEPARPLHERRGKHSPYKDVSGVLRSFDYAAAMALNVQGVDHSPE
AAVSRKRVTDRYLKEARQAFIQAYQSATSTLAHDWQDAKGQDAALTLFSLEKAAYEVAYE
AENRPTWLPVPLQGLHGLLSGIASIKEAPISKTARGGETS
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagaaacccaacgctgccaccttcatcaaagacccgctctggtacaaggacgcg
gtgatctaccaggttcacgtcaaatcctatttcgactccaataacgacggtatcggtgat
tttcccggcctgatcgccaagctcgactacatcgcggacctgggtgtaaacaccatttgg
ctattgccgttctacccctcgccacgtcgcgacgacggctatgacattgccgaataccgt
ggcgtgcacagcgactacgggaccctggccgacgccaagcgctttattgccgaggcgcac
aagcgcgggctgcgggtgatcaccgagctggtgatcaatcacacctccgaccagcacccc
tggttccagcgcgctcgcaaggccaagcccggctcggcggcgcgggacttctacgtgtgg
tcggatgatgaccagaaatacgacggcacgcgcatcatcttcctcgataccgagaagtcc
aactggacctgggacccggtcgccggccaatacttctggcaccgtttctattcccaccag
cccgacctcaacttcgacaacccccaggtgatgaaagccgtgttgtcggtgatgcgctac
tggctggacatgggcatcgacggcctgcgcctcgacgccatcccgtacctgatcgagcgc
gacggcaccaacaacgagaacctgcctgaaacccacgacgtgctcaagcagatccgtgct
gagatcgacgcgcattacccggaccgcatgctattggccgaagccaatcagtggccggaa
gacacccagctctactttggtgacaaaaagggcgacgacggcgatgagtgccacatggcc
tttcacttcccgctgatgccgcgcatgtacatggccctggcccaggaagaccgcttcccg
atcaccgatatcctacggcagaccccggagattccggccaactgccaatgggcgatcttc
ctgcgcaaccacgatgagttgaccctggaaatggtcaccgacaaggagcgcgactacctg
tggaactactacgccgctgaccgccgggcgcggatcaacctgggcattcgtcgccgtctt
gcgccattgatggagcgtgatcgtcgccgtgtcgagttgctcaacagcctgttgctgtcg
atgcctggcacgccgaccctgtactacggcgatgagatcggcatgggcgataacatctat
ctcggcgaccgcgatggcgtacgcacgccgatgcaatggtccatcgaccgcaacggcggt
ttttcccgcgccgacccggccagcctggtactgccgccgatcatggacccgcaatacggc
taccagtcggtgaatgtcgagactcaggcccaagacccgcattcgctgctgaactggacc
cggcgcatgctggcggtgcgtaagcaatccaaggcgttcggccgtggcagcttgaaaatg
ctctcgccgagcaaccgccgcatcctggcctatacccgtgaattcaccggcgaagacgga
cgcaacgaaatcatcctctgcgtggccaacgtgtcgcgcagcgcccaggcggccgagctg
gacctgtcggcattcgccggcatggtgccggtggagatgttgggcggtaatgctttccca
cccatcggccagctgaatttcctgctgaccctggcgccttacgggttctattggtttgtg
ctggcgccggaaaaccagatgccgagctggcacgtggaacccgcccagagcatgccggac
ttcactacattggtattgaaaaaacgcatggaagaattgctggacgaaccctgccgcgca
tccttggaacagaccgcactgccggcctggttgcccaagcgccgttggttcgccggcaag
gacacggccatcgacagcgtgcgcatcgcctacggtgtgcgctttggcgatccccagcat
cctgtgttgctcagcgagcttgaagtgacggccggtggccaggtcagccgttatcagttg
ccgttcggcttcctcggtgaagaccagttcaccagcgccttgccgcagcaattggccttg
gcccgtgtacgccgagtgcgtcaggtggggttggtgactgatgcctttagcctcgaacac
tttatccgcgccgtcatccagggtttgcaggcgggcaccgtgctcaacaccaacgaaggc
gagctgcgctttgccgccacgccgcacctggccaagctgcaactgacggatgagtccgaa
gtgcgttacctgtctgccgagcagtccaacagttcggtggtggtgggtgaaagcctggtg
ctcaaactgatccgcaaagtcgcttccggcgtgcacccggaactggagatgagcgcctac
ctgaccgctgccggctacccaaacatctcgccgctgctgggctcgatggtgcgccatgat
gcccaagggcaggacaacctgctgatgattgcccagggctacctgagcaaccagggcgac
gcctggagctggacccagaacaacctggaacgggcgattcgcgacgagctggccgaagcc
atctccgaacaggaacagcactacaacgccctgggcgagctggcggattttgccgggttg
ctcggccaacgcctgggtgaaatgcacctggtactcggcgcgaaaaccaccaacaaggac
ttcaagcccgaagtcaccacggccaaggacacccaggcctgggccaaggacgtcggcgcg
cagctggaccgcgcgttgcagttgctcaaactgcatcaaagccaattgaacccggccgat
caagcgctggtcagtgatttgctggcgcagaaaaaagccatcgccagtcatgtacaggcc
ttggcaaaagccacggcgggcggcttgcgtattcgggtgcatggtgacttgcatttgggc
caggtgctggtggtgaaaggcgatgcctacctgatcgattttgaaggcgaaccggcgcgg
cccttgcacgaacgccgcggcaagcacagcccgtataaagatgtgagcggcgtgttgcgc
tcgttcgactacgcggcggccatggccttgaatgtgcaaggggtggatcactcgcccgaa
gcggcggtgtcgcgtaagcgcgtcaccgatcgctacctgaaagaagcgcgtcaggcattt
atccaggcttatcagtcagctacgtctacactggcgcatgactggcaggacgccaagggc
caggacgctgcgctgacgttgttcagcctggagaaggccgcgtacgaagtggcctacgaa
gcagagaaccgtccgacttggttgccggtgcccctgcaagggttgcacggtttactgagc
gggattgcttctataaaggaagcacctatatctaaaactgcacgcggtggggagacgtca
tga

DBGET integrated database retrieval system