KEGG   Pseudomonas azotoformans: AYR47_21750Help
Entry
AYR47_21750       CDS       T04879                                 

Gene name
ligD
Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pazo  Pseudomonas azotoformans
Pathway
pazo03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pazo00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    AYR47_21750 (ligD)
Enzymes [BR:pazo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     AYR47_21750 (ligD)
DNA repair and recombination proteins [BR:pazo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     AYR47_21750 (ligD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_C DNA_ligase_A_M DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AMN80765
UniProt: A0A127I1L8
LinkDB All DBs
Position
complement(4731310..4733769)
Genome map
AA seq 819 aa AA seqDB search
MSKPLSEYNRKRDFGITAEPAGSAPGTKRKASALSFVIQKHDARNLHYDFRLELDGVLLS
WAVPKGPSLDPSQKRLAVHVEDHPLSYGGFEGSIPAGQYGAGDVIVWDRGIWQPHDDPRK
AYAAGKLKFTLVGEKLSGDWALVRTRLKGSGDKQQWLLIKEKDPQARAADDYDIVQAQPN
SVLSDASVGTSKARAKARKTQFPEQFTPQLATLVDRAPEGDWQYEIKFDGYRMLARIQDG
DVRLFTRNGHDWTDRLPRQVKALQALKLKDSWLDGEVVSLNGDGLPDFQALQNAFDIGRS
LDIVYYVFDAPFLNGQDQRLAPVEDRRAALKVALAGSRSKLLRFSEAFTAHHRDIFESAC
DLALEGVIGKRLGSPYVSSRNADWIKLKCRLRQEFVIVGYTRPQGSRTGFGALLLAVNDE
TGLVYAGRVGTGFDQASLKTIYAQLTSLERKTSPLEKPLTSTQARGVHWVAPTLVGEVQF
AEWTREGVVRQAAFVGLRTDKPAAQIVHEQPRTAKSMKPAKKTRSDVNITHPDRVIDKQS
GTQKQQLAQFYDSISQWILPFLHHRPVSLLRAPEGIEGEQFFQKHSERLAIPNIKQLDQA
LDPGHARLMEIDNVGALIGAVQMGSVEFHTWGATSDKIETPDQFVLDLDPDPALPWKTML
EAAQLTLSVLDELGLQAFVKTSGGKGLHLIVPLARRDGWDTVKAFAKAIAQFMTEQLPER
FTATSGPKNRVGKIFIDYLRNARGASTVAAYSVRARPGLPVSVPVSREELKGLRGAQQWT
VANLQQRLNTLKTDPWAGYANRQKISKRMWDKLSAHPPK
NT seq 2460 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcccctcagcgaatacaaccgcaagcgcgatttcgggattaccgccgaaccg
gcaggcagtgcgcctggtaccaaacgcaaagcctcggcgctgtccttcgtgatccagaag
cacgacgcacgcaacctgcactatgactttcgcctggaactcgatggcgtgctgctcagt
tgggccgtgcccaaaggcccgagcctggatcccagccagaagcgcctggccgtgcatgta
gaagatcatccgctgagctacggcggctttgaaggcagcattcccgccggtcagtacggc
gccggtgatgtcatcgtgtgggaccgtggcatctggcagccccatgacgatccccgcaag
gcctacgcggccggcaagctcaaattcaccctggtcggcgagaaactctccggcgactgg
gcgctggtgcgcacgcgcttgaaaggcagcggcgacaagcaacaatggctgctgatcaag
gaaaaggacccgcaggcgcgcgcggccgacgactacgatatcgtccaggcccagccgaac
agcgtgctcagcgatgcttcagtgggaacatccaaggctcgggccaaagccaggaaaacc
cagtttcccgagcaattcaccccgcaattggccaccctggtggatcgcgcccccgaaggc
gattggcaatacgaaatcaaattcgacggctaccgcatgcttgcacgcattcaggacggc
gacgtgcgcctgtttacccgcaacgggcatgactggaccgaccgtctgccgcgccaggtc
aaggccttgcaggctctgaagctcaaggacagctggctggatggcgaggtggtcagcctc
aatggcgacggcctgccagacttccaggcgctgcaaaatgcttttgatatcggccgtagc
ctcgacatcgtctactacgtgttcgatgccccctttctcaacggccaggaccaacgcctg
gcgccggtcgaggatcgccgtgccgctctaaaggtcgcgctggccggtagccgcagcaaa
ttgctacgtttttccgaggcattcactgcgcaccaccgtgacatctttgaaagcgcctgc
gacttggccctcgaaggcgtgatcggcaagcgcctgggcagtccgtacgtctccagccgc
aatgccgactggatcaaactcaaatgccggttgcgccaggagttcgtgattgtcggctat
acccggccgcaaggctcacgcacggggttcggcgcgttgttgctggcagtaaatgatgag
actggcctggtgtacgcaggccgcgtgggcacgggttttgatcaagcatcgctcaagact
atctatgcgcaactgacatcgttggagcgcaagacatcgccgcttgagaagccgctgacc
agcacccaagcacgaggcgtgcattgggtagcgcccacgttggtcggtgaggtgcagttt
gccgagtggacacgcgagggcgtggtccgccaagccgcattcgtcgggctgcgcaccgac
aagccggcagcgcagattgttcatgaacaaccgcgaacggccaaatccatgaagcctgcc
aagaagacccgcagtgatgtgaatatcacccacccagaccgcgtgatcgacaaacaaagc
ggcacgcaaaaacagcaactggcgcagttctacgacagcatcagccagtggattctgccc
tttctgcaccatcggccagtgtcactgctgagagcacccgaaggtatcgagggcgagcaa
ttcttccagaaacactcggagcgcctggcgatacccaacatcaagcagctcgaccaggca
ctcgatcccggccatgcgcggctgatggaaatcgacaacgtcggcgcgctgatcggtgcc
gtgcaaatgggctcagtggagtttcacacctggggcgccacctcggacaagatcgaaacc
ccggaccagtttgtgctcgatctcgacccggacccggcattgccctggaaaaccatgctg
gaggccgcgcaactgaccctgtcggtgctggatgagctggggctgcaagcgttcgtcaag
accagcggtggcaaaggcctgcacctgatcgtaccgttggcgcgtcgggacggctgggac
accgtcaaagcattcgccaaggccatcgcccagttcatgaccgagcagttgccggaacgc
tttaccgccacatcggggcccaagaaccgggtcggcaagatctttatcgattacctgcgt
aatgcacggggagccagcaccgtagccgcgtattccgtgcgtgcgcggccgggtttgccg
gtgtcggtgccggtcagtcgtgaggagttgaaggggctgcgcggtgctcaacaatggaca
gtcgccaatctgcagcaacgtttgaatactttgaaaacggatccctgggcgggatatgcc
aatcgacagaagatcagcaagaggatgtgggacaaactgagcgcccatccaccgaagtga

DBGET integrated database retrieval system