KEGG   Pseudomonas azotoformans: AYR47_22750Help
Entry
AYR47_22750       CDS       T04879                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pazo  Pseudomonas azotoformans
Brite
KEGG Orthology (KO) [BR:pazo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AYR47_22750
Enzymes [BR:pazo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AYR47_22750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored DAO FAD_binding_3 AlaDh_PNT_C Thi4 NAD_binding_8 Glutaredoxin FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AMN80950
UniProt: A0A127I303
LinkDB All DBs
Position
complement(4984197..4985762)
Genome map
AA seq 521 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVVSLTTLITLKTDGDDAR
KPSFSINRPGAEISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVEVIEQIRTLKGEFSF
ETYFSLSCQNCPDVVQALNLMAVLNPNIRHVAIDGALFQAEVDERQIMAVPSVYLNGVNF
GQGRMGLEEILAKLDTSGIEKAAEKISAKDAFDVLVVGGGPAGSAAAIYAARKGIRTGVA
AERFGGQVLDTMSIENFISVQETEGPKLASALEAHVRQYDVDIMNLQRASSLVPAKNAGD
LHEIRFESGATLKSKTVILATGARWREMGVPGEQEYKAKGVCFCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVSHVTLLEFDSKLRADAVLQRKLYSLPNVDVITSALTSEVKGDG
QKVTGLAYKDRDSGEFKTIDLEGIFVQIGLLPNTDWLKGTVELTPRGEIIVDARGETSLP
GVFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgtcgcctccctcgacgacggtgcgaaatcccaggaaatgcttgcccttttg
caggatgtggtcagcctcacgacgctgattaccctgaaaaccgatggtgatgatgcgcgc
aagccgtcgttctccatcaaccgcccaggtgccgagatcagcctgcgtttcgccggcatc
ccgatgggccatgaattcacttcgttggtgctggccctgctgcaagtcggtggccacccg
tcgaaggccagtgtcgaagtcattgaacagatccgcaccctcaaaggtgagttcagcttc
gagacttacttctcgctgtcctgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtgctcaacccgaacatccgccacgtcgccatcgacggcgcgctgttccaggct
gaagtcgacgagcgccagatcatggcggtaccgagtgtttacttgaacggtgtgaacttc
ggtcagggccgtatgggcctggaagagattcttgccaagctcgacaccagtggcattgaa
aaagccgccgagaaaatcagcgccaaagacgcctttgatgtacttgtcgtcggcggcggc
ccagccggttctgcggccgcgatctacgctgcacgtaaaggcatccgtaccggcgttgct
gccgagcgttttggcggccaagtgctggacaccatgtccatcgagaacttcatctcggta
caagagaccgaagggccgaaactggccagcgcactggaagcccacgtgcgtcaatacgac
gtggacatcatgaacctgcagcgcgccagcagcctggtgcctgcgaaaaacgccggcgac
ttgcacgaaattcgttttgaaagcggtgcgaccctgaagtccaagaccgtgatcctggcc
accggcgcccgctggcgcgaaatgggtgtgccgggcgagcaggaatacaaggctaaaggc
gtgtgcttctgcccacactgcgacggtccgctgttcaagggcaagcgtgtggcggtgatc
ggcggtggtaactccggcgttgaggcggccatcgacctggccggtatcgtcagccacgtg
accttgcttgagttcgacagcaaattgcgcgccgacgccgtgctgcaacgcaagctctac
agcctgccgaacgttgacgtgatcaccagtgcgttgactagcgaagtgaaaggcgatggc
cagaaagtcaccggcctggcgtataaggatcgcgacagcggcgagttcaagaccatcgat
ctggaagggatctttgtacagatcggtttgctgcccaacaccgattggctcaaaggcacc
gtggaactgacgccacgcggcgagattatcgtcgatgcgcggggtgagacttcactgcca
ggcgtattcgccgccggcgacgtgacgacggtgccgtacaagcagatcgtgattgcagtg
ggcgagggcgccaaggcttccctgagcgctttcgatcacttgatccggacttccgccccg
gcgtaa

DBGET integrated database retrieval system