KEGG   Pseudomonas azotoformans: AYR47_24400Help
Entry
AYR47_24400       CDS       T04879                                 

Definition
(GenBank) iditol 2-dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
pazo  Pseudomonas azotoformans
Brite
KEGG Orthology (KO) [BR:pazo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AYR47_24400
Enzymes [BR:pazo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     AYR47_24400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PALP FAM72
Motif
Other DBs
NCBI-ProteinID: AMN81255
UniProt: A0A127I300
LinkDB All DBs
Position
5342936..5344051
Genome map
AA seq 371 aa AA seqDB search
MSTVTERPQEQLSPIIPKTMQAVVCHGPEDYRLETVDVPTPGPEEVLTKVELCGICMGDI
KTYRGAPSFWGDAEQPRYVKPPMIPGHEFVCRVVALGPGAEKRGVKIGDRVISEQIVPCW
GCRFCNHGQYWMCQKHDLYGFQNNVQGAMAQYMIFTKEGIIHKVPDSIAPDEAILIEPLA
CSLHAAERANVDFDDVVVVAGAGTLGLGIIGAVRMRNPKKLIVLDMKPERTALALRMGAD
EVWNPAEVDVLAKIREITDGYGCDIYIEATGHHKAVNQGLAMLRKLGRFVEFSVFNDEAT
VDWSIIGDRKELDVLGSHLGPYMYPRAIDFIGNRKIDMRDVVTHKFALADFKEAFAVMER
GDKSLKVVLEP
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcaccgaacgcccgcaagaacaactgtccccgatcattccgaaaaccatg
caggccgtggtctgccatggcccggaagactaccggctggaaaccgtcgacgtgcccacg
cccggccctgaggaagtcctcaccaaggtcgagctgtgcggcatctgcatgggcgacatc
aagacctatcgcggcgcgccctcgttctggggtgatgccgaacaaccgcgctatgtgaaa
ccgccaatgatccccggccatgagttcgtctgccgcgtggtcgccctcggccctggcgcg
gaaaaacgcggcgtgaagattggcgaccgggtcatttccgagcagatcgtgccgtgctgg
ggctgccgcttctgcaaccacggccagtactggatgtgccagaaacacgacctgtatggc
ttccagaataatgtgcagggggccatggcccagtacatgatcttcaccaaggaaggcatc
atccataaagtccccgactccatcgccccggacgaagccatcctgatcgaaccgctggcc
tgctcgctgcacgccgccgaacgcgccaatgtggatttcgatgatgtggtggtggtcgcc
ggcgccggcacactgggcctgggcatcatcggcgcggtgcgcatgcgcaacccgaaaaag
ctcatcgtgctggacatgaagcccgaacgcaccgccctcgccctgcgcatgggcgccgac
gaggtgtggaaccccgccgaagtcgacgtgctggccaagatccgtgaaatcaccgacggc
tacggttgcgatatctacatcgaagccaccggtcatcacaaggcggtcaaccagggcctg
gcgatgctgcgcaagctggggcgcttcgtcgagttcagcgtgttcaatgacgaggccacg
gtggattggtcgatcattggcgaccgcaaggagctggatgtactcggctcgcacctgggg
ccctacatgtacccgcgcgccatcgactttatcggcaaccgcaagatcgacatgcgcgac
gtggtcacccacaagttcgccctggcggatttcaaggaagcctttgccgtgatggagcgc
ggcgacaaatccctcaaggttgtgcttgagccctga

DBGET integrated database retrieval system