KEGG   Pseudomonas azotoformans: AYR47_26010Help
Entry
AYR47_26010       CDS       T04879                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
pazo  Pseudomonas azotoformans
Brite
Enzymes [BR:pazo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AYR47_26010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AMN81553
UniProt: A0A127I4D6
LinkDB All DBs
Position
5674359..5674880
Genome map
AA seq 173 aa AA seqDB search
MNRSLLLGLLSVFAVGSAQAASLQVPVNLVSADGAPQPVGSITISESAYGLIFTPDLKSL
PMGVHGFHIHENGSCEAGVKDGVKVAALAAGGHFDPEKTGKHLGPYADGHLGDLPALYVN
MDGTSNNPVLAPRLKSLAQIKGHALMIHAGGDNHSDMPKPLGGGGERLVCGVI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctctcttctgctcggcctgctcagtgtcttcgcggtcggctccgcccaggcg
gcgtcgttgcaagtcccggtcaacctggtcagtgccgatggtgcgccacagcccgtcggt
agcatcaccatcagtgaatcggcctacggcttgattttcacccctgatctcaaatccttg
ccaatgggcgtgcacggctttcatatccatgaaaacggcagctgtgaagcgggtgtgaaa
gacggcgtgaaagtcgcggcactggccgccggcggacacttcgacccggaaaaaaccggc
aagcacctgggcccttacgccgacggccacttgggtgacctgccggcgctgtacgtgaac
atggacggcacctcgaacaacccggtgctcgcgccccgcttgaaaagcctggcgcagatc
aagggccacgcgctgatgatccatgccggcggcgacaaccattccgacatgcccaagcca
ttgggcggtggcggtgagcgactggtgtgcggcgtgatttaa

DBGET integrated database retrieval system