KEGG   Pseudomonas azotoformans: AYR47_26650Help
Entry
AYR47_26650       CDS       T04879                                 

Definition
(GenBank) iditol 2-dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
pazo  Pseudomonas azotoformans
Brite
KEGG Orthology (KO) [BR:pazo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AYR47_26650
Enzymes [BR:pazo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     AYR47_26650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 DUF43
Motif
Other DBs
NCBI-ProteinID: AMN81668
UniProt: A0A127I495
LinkDB All DBs
Position
complement(5815316..5816395)
Genome map
AA seq 359 aa AA seqDB search
MDKHTDMQAVVCHGPKDYRLERIGKPQARANELVIRIAACGICASDCKCHSGAAMFWGGD
NPWVKAPVVPGHEFFGYVVEVGEGAEEHFEVAIGDKVIAEQIVPCGKCRFCKSGKYWMCE
VHNIFGFQREVAEGGMAQYMRIPKTAIVHKIPESVSLEDSALVEPMACSIHTVNRGDIQL
DDVVVIAGAGTLGLCMVQVAALKTPKKLVVIDMVDERLELAKKFGADVVINPSRDNAREI
INGLTDNYGCDVYIETTGVPAGVTQGLDLIRKLGRFVEFSVFGAETSVDWSIIGDRKELD
VRGAHLGPYCYPIAIDLFERGLVTSKGIVTHDFPLDDFAEAFALANSTKSIKVLLKPVA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacaagcacaccgacatgcaagccgtcgtctgccacggcccgaaagactatcgcctg
gaacgcatcggcaaaccccaggcgcgcgccaatgaactggtgatccgcatcgccgcctgc
ggcatctgcgccagtgactgcaagtgccactcgggcgccgcaatgttctggggcggcgac
aacccgtgggtcaaggcgccggtggtgccggggcacgaattttttggctatgtggtggaa
gtgggcgagggcgccgaagagcacttcgaagtcgccataggcgacaaggtgatcgccgag
cagatcgtgccgtgcggcaagtgccgtttctgcaagtcgggcaagtattggatgtgcgaa
gtgcacaacatcttcggcttccagcgtgaagtcgccgaaggcggcatggcccagtacatg
cgcattcctaagaccgccatcgtgcacaagatccccgagtcggtgtcgctggaagactcg
gcgctggtggaaccgatggcctgctcaatccatacggtcaaccgtggcgatatccagctc
gacgacgtggtggtgatcgccggcgccgggaccctcggcctgtgcatggtccaggtcgct
gcgttgaaaaccccgaagaaactggtggtgatcgacatggtcgacgagcgcctggaactg
gcgaaaaaattcggcgccgatgtggtgatcaacccgtcgcgcgacaacgcccgcgaaatc
atcaacggcctgaccgacaactatggctgcgacgtctacatcgaaaccaccggcgtgccg
gcgggcgtgacccagggcctggacctgatccgcaagctcggacgttttgtcgagttcagc
gtgtttggcgccgagaccagcgtcgactggtcgatcatcggcgaccgcaaggagctggac
gtacgcggcgcccacctcggcccgtattgctacccgatcgccatcgacctgttcgaacgc
ggcctggtcacctccaagggcatcgtcacccatgacttcccgctggacgactttgccgag
gccttcgcgttggccaattcgactaagtcgatcaaggtgctgttgaagccggtggcctga

DBGET integrated database retrieval system