KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a1076Help
Entry
PSEBR_a1076       CDS       T01472                                 

Definition
(GenBank) 3-hydroxydecanoyl-[acyl-carrier-protein] dehydratase ((3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase)
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00061  Fatty acid biosynthesis
pba00780  Biotin metabolism
pba01100  Metabolic pathways
pba01212  Fatty acid metabolism
Module
pba_M00083  Fatty acid biosynthesis, elongation
pba_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:pba00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    PSEBR_a1076
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    PSEBR_a1076
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pba01004]
    PSEBR_a1076
Enzymes [BR:pba01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     PSEBR_a1076
Lipid biosynthesis proteins [BR:pba01004]
 Fatty acid synthase
  Component type
   PSEBR_a1076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT 4HBT_2 MaoC_dehydratas
Motif
Other DBs
NCBI-ProteinID: AEA67250
UniProt: F2KDT1
LinkDB All DBs
Position
1353108..1353548
Genome map
AA seq 146 aa AA seqDB search
MMDINEIREYLPHRYPFLLVDRVVDLDVEGKRIRAYKNVSINEPFFNGHFPAHPIMPGVL
IIEAMAQAAGILGFKMLDVKPADGTLYYFVGSDKLRFRQPVTPGDQLILEAKFISCKRQI
WKFECQASVDGKPVCSAEIICAERKL
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgatggacatcaacgagattcgcgaatacctgcctcaccgttacccgttcctgctggtg
gatcgggtggtggacctggacgttgaaggcaagcgcattcgcgcctacaagaatgtcagc
atcaacgagccgttcttcaatggtcacttccctgcgcatccaatcatgccgggtgtattg
atcatcgaggcaatggctcaggctgccgggatccttggcttcaaaatgctcgacgtaaaa
cctgccgacggcacgctctattacttcgtcggttccgacaagctgcgtttccgccagcca
gtcaccccgggcgatcagttgatcctcgaagccaagttcatcagttgcaagcgccagatc
tggaaattcgaatgccaggcttcggtcgacggcaagccagtctgctccgctgaaatcatc
tgtgcggaacgcaaactatga

DBGET integrated database retrieval system