KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a1887Help
Entry
PSEBR_a1887       CDS       T01472                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00010  Glycolysis / Gluconeogenesis
pba00052  Galactose metabolism
pba01100  Metabolic pathways
pba01110  Biosynthesis of secondary metabolites
pba01120  Microbial metabolism in diverse environments
pba01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSEBR_a1887
   00052 Galactose metabolism
    PSEBR_a1887
Enzymes [BR:pba01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PSEBR_a1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEA68107
UniProt: F2K9P5
LinkDB All DBs
Position
complement(2301683..2302834)
Genome map
AA seq 383 aa AA seqDB search
MLESRQLLTALGVSLMIATSASHAAGLTNERGAFGKTDDGTAVEKFVLRNSHGMEATVIT
YGGILQSLSVPDKHGKAADIVLGFDDVQGYQKNGSVYFGATIGRFGNRLADGAFELDGKR
YQVPQNDHGNSLHGGPQGFDKRVWKAQPHNAKDSVGVTLTYLSADGEMGFPGALKTDVTY
SLNEQNELRIEYKATTDKPTVLNLTNHSYFNLAGAGNGDILEQVATLHAAHYTPVTGKLI
PTGELAPVAGTPMDFTQPTAIGTHIKADHPQLKFAEPKQGGFDFNWALDAKGDVNKLAAE
VYDTDSGRRLQLYTTEPGVQFYTSNFLDGTVKGKQGKVYPHWGAFTLETQHYPDSPNQPN
FPSTRLDPGQTYTQTMVLKFSAK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaatccagacaactgctcacggccctcggagtgtctctgatgatcgccacctcg
gcttcccacgctgccggcctgaccaacgaacgtggtgcgttcggcaaaaccgacgacggc
acggcggtggaaaaattcgtgctgcgcaacagtcacggcatggaggccacggtcatcacc
tacggcggcatcctccagtcattgagcgtgccggacaaacacggcaaggccgccgacatc
gtgctcggcttcgacgacgtgcagggttaccagaagaacggcagcgtgtatttcggcgcg
accatcggccgcttcggcaatcgcctggccgacggcgccttcgagctggacggcaagcgt
taccaggtgccgcagaacgaccatggcaattccttgcacggcgggccgcaagggttcgac
aagcgcgtctggaaggcccagccccataatgccaaggactcggtgggcgtcaccctgacc
tacttgtcagccgatggcgagatgggtttccccggtgcactgaagaccgacgtcacctac
agcctcaacgaacagaacgagttgcgcatcgagtacaaagccaccaccgacaagcccaca
gtgctgaacctgaccaaccacagctatttcaacctggccggggcaggcaacggcgacata
ctcgagcaggtcgcgaccctgcacgcggcccattacacgccggtcaccggcaagctcatt
cccactggcgaactggcccccgtggccggcacaccgatggacttcacccaacccaccgcc
atcggcacccatatcaaggccgatcacccacaactcaaattcgccgaaccgaaacaaggc
ggcttcgatttcaactgggcgctggacgccaagggcgacgtgaacaaactggccgccgag
gtgtatgacacggactccggacgacgcctgcagctctacaccaccgagcctggcgtgcag
ttctacaccagcaacttcctcgacggcaccgtcaagggcaagcaaggcaaggtctatcca
cattggggcgcgttcaccctggaaacccagcactaccccgactcgcccaaccagccgaac
ttcccttcgacgcggcttgatccgggccagacctacacccagaccatggtgttgaagttc
tccgcgaaataa

DBGET integrated database retrieval system