KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a2200Help
Entry
PSEBR_a2200       CDS       T01472                                 

Definition
(GenBank) putative transporter, membrane protein
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_3 Sugar_tr
Motif
Other DBs
NCBI-ProteinID: AEA68472
UniProt: F2KGL3
LinkDB All DBs
Position
complement(2720580..2721758)
Genome map
AA seq 392 aa AA seqDB search
MATYSLVIRRLMIVSLTIVVSRAITSPLLTLFLSNKLGLNQQDVGLLLGIAVFIATLLAL
YGGYVIDRLEKRRLLILAMLSSAIGFILLTFAENLYLTTMTVVITETASALFLIGSKAIL
SENLPMGQRAKAFSLRYTLTNIGYATGPMLGVVIAGVYPIAPFLIAAGIAFFSIFLMTGI
PRDAAPPAVIGQPPSFLKTLKTLKNDRTLIMFTCGCLLSTVVHGRFTLYLSQYLLVTHES
KRALDIMAALLACNAITVIVLQYQIGRFLDREKLRYWIAAGTSLFMLGLIGFSLADDMVS
WCVAMFIFTLGEMIIYPAEFLFVDTLAPEKLRGSYYGAQNLAALGGALSPVICGYLLMHT
PAPTMFYALSALTAMGGLLCFMSGRRMAIVKK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggccacttactcgctcgttatccgacgcttgatgatcgtttcactgaccatcgtcgtc
agccgcgccattaccagtccattgctcacgctatttttgagcaacaagttgggcctcaac
caacaagatgtcggcttgctgctcggtatcgcagtgttcatcgccaccctgttggcgctg
tatggcggatatgtcatcgatcgcctggaaaagcgccgcctgctgatcctggcgatgctc
tccagtgccatcggtttcatcctgctgacctttgccgaaaacctctacctgaccaccatg
accgtggtgatcaccgagaccgcgtcagcgctgttccttatcggttcgaaagcgatcctc
agcgaaaacctgcccatgggccagcgcgccaaggcattttccctgcgctacaccctgacc
aacatcggctatgccaccggccccatgctcggcgtggtgattgccggtgtctacccgata
gcgccgttcctgatcgccgctggcatcgcgtttttcagcatcttcctgatgaccggcatc
cccagggatgccgcgccgccagcggtcattggtcaaccacccagttttctcaagacgctc
aagaccctgaaaaacgaccgtaccctgatcatgttcacgtgcggctgcctgctcagcacc
gtggtgcacggacgcttcaccctctacttgtcgcaatacctgctggtgacccacgaatcc
aaacgcgcgctggacatcatggccgccctgctcgcctgcaacgccatcaccgtaattgtg
ctgcaataccagatcggccggttcctcgatcgcgagaagttgcgctactggattgccgcg
ggcaccagcctgttcatgcttggcctgatcggcttcagcctggcggacgacatggtgagc
tggtgcgtggcgatgttcattttcaccctcggtgaaatgatcatttacccggccgaattc
cttttcgtcgataccctggccccggaaaaactgcgcggcagctactacggtgctcaaaac
ctggcagcgctcggcggcgccctgagcccggtgatctgcggatacctgctgatgcacacc
ccggcaccgacgatgttctatgcgttgagcgcgctgaccgcgatgggaggcctgctgtgc
ttcatgagtggtcgccggatggctattgtgaaaaagtaa

DBGET integrated database retrieval system