KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a2838Help
Entry
PSEBR_a2838       CDS       T01472                                 

Definition
(GenBank) Putative DNA ligase (ATP)
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pba00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    PSEBR_a2838
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pba03400]
    PSEBR_a2838
Enzymes [BR:pba01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     PSEBR_a2838
DNA repair and recombination proteins [BR:pba03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     PSEBR_a2838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S mRNA_cap_enzyme
Motif
Other DBs
NCBI-ProteinID: AEA69138
UniProt: F2KHD2
LinkDB All DBs
Position
3513766..3516381
Genome map
AA seq 871 aa AA seqDB search
MSSKTLDDYNRMRNFAATPEPAAKRSRKSAKTAHALQFCIQKHDASRLHYDFRLELDGAL
KSWAVPKGPSLDPKAKRLAVHVEDHPLDYATFEGNIPEGHYGAGDVIVWDRGVWIPQDDP
HEAYEKGRLKFELQGEKLSGLWNLVRTHMPGKQEQWFLIKHQDQAARPESEYDVVQAEPN
SVLSDRTLVPKRRGKAAAAKAVKQPEKAVQAKSPRGAAKTTLSGAVAGPLPDTLKPELAT
LVESAPDGEWLYEIKFDGYRVMACIEHGDVRLLTRNGHDWTHKLPRQAEALAELGLESAW
LDGEMVVANDQGVPDFQALQNAFEAGSSGKIAYYLFDMPYLNGMDLRKVPVQERRAALAA
VLEPNESPLLRFSDAFEETPEALLNSACQMQMEGLIGKRIGSAYVSRRSNDWIKLKCKNR
QEFVVVGFSDPKGARSAFGALLLGLHDADSGQLRYAGKVGTGFNETTLKSIYQQLLPLET
KKAAVVNPPSGYEAKGVHWLEPTLLAEVAFAEMTKDGSVRHAVFHGLRNDKPAKDITQEL
VKPVKKTAAAKKTKAKHEPGATPAKTKSKAKAPALDGKVRITHPERVIDASSGTTKLQLA
EYYASVAEFILPELADRPVALVRAPDGIAGELFFQKNAERLAIPGITSLDKALTGQPVMI
INNAEALIGAVQMSTVELHTWNATSVDLDKPDRFVLDLDPDPALPWKSMVEATQLTLSVL
DELGLKAFLKTSGGKGIHVVVPLTRKLGWDEVKGFSHAIVSHMAKLLPDRFSAVSGPKNR
VGRIFIDYLRNGLGATTICAYAARTREGLPVSVPVFREEVAELKGANLWNVHNVHERLAE
VGHEPWAGLKRTRQSITAEMRRRIGMRETDK
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaagaccctggatgactacaaccgcatgcgcaactttgccgccaccccggag
ccggcggcgaagcgctcgcgcaaatcggcgaagactgcccatgccttgcagttctgtatt
caaaaacacgacgcctcgcggctgcattacgattttcggctggagctggacggtgcgctc
aagagctgggcggtgcccaaaggcccctccctggacccgaaagccaagcgcctggcggtg
catgtcgaagaccatccgctggattacgccacgttcgaaggcaacatccccgagggccat
tacggcgccggtgacgttatcgtctgggatcggggcgtctggattccccaggatgatccc
catgaggcctatgaaaagggccggctcaagttcgaactgcaaggcgaaaagctcagcggc
ctgtggaacctggtgcgcacccacatgcctggcaagcaggagcagtggttcctgatcaaa
catcaggaccaggccgcccgccccgagagtgaatacgacgtggtccaggccgaaccgaac
agcgtgctcagcgatcgcaccctggtgcccaagcgccgcggcaaggccgctgcagccaaa
gcggtgaaacaaccggaaaaggccgtgcaggcgaaatcgccaagaggcgccgcgaaaacc
accctcagcggcgcggtcgccggaccgttgccggacaccctcaagccggaactggcaaca
ctggtggaaagcgcgcccgacggcgagtggctctatgaaatcaagttcgacggttaccgg
gtcatggcgtgcatcgaacacggcgacgtaaggctgctgacccgcaacggccatgattgg
acccacaaattgccaagacaggccgaagccctggctgagctgggcttggaatcggcctgg
ctcgacggcgagatggtggttgccaacgaccagggcgtgccggacttccaggccttgcag
aatgccttcgaggccggcagcagtggcaagatcgcctattacctgttcgacatgccgtac
ctcaatggcatggatttgcgcaaagtgccagtgcaagaacgccgggcggcattggccgca
gtgctggagcccaatgaaagccccttgctgcggttttccgatgctttcgaagaaactccc
gaagcgctgctcaacagcgcctgccagatgcagatggaagggttgatcggcaagcgcatc
ggcagtgcctatgtgtccaggcgcagcaacgactggatcaagctcaagtgcaagaatcgc
caggagttcgtggtggtgggcttcagcgatcccaagggcgctcgcagcgccttcggtgcc
ttgctgctggggctgcatgacgctgacagcggccagttacgctatgccggcaaggtcggc
accgggttcaacgaaaccacccttaaaagcatctaccagcaactgctgcccctggagacc
aaaaaggccgccgtggtcaacccgcccagcggttacgaagccaagggcgtgcactggctc
gaaccgacgctgttggccgaagtggcctttgccgaaatgaccaaggacggctcggtgcgc
catgcggtcttccatggcttgcgcaacgacaagccggccaaggacattacccaggagctg
gtcaagcccgtgaaaaaaaccgctgcggcaaaaaaaaccaaagccaagcatgagcctggc
gcgacaccggccaaaaccaagagcaaggccaaggcaccggccttggacggcaaggtccgc
atcactcatccggagcgggtcattgacgccagcagcggcaccaccaagctgcaactggcc
gagtactacgccagcgtggccgaattcatcctgccagaactggcggatcgcccggtggcc
ttggtcagggcgccggatggcatcgccggggaactgttcttccagaagaacgccgagcgc
ctggcgattcccggtatcaccagtctggacaaggcgctgaccgggcagccggtgatgatc
atcaacaacgccgaagcgctgatcggcgcggtgcagatgagcacggtggagctgcacacc
tggaacgccacctcggtcgatctggacaagcctgaccgcttcgttctcgaccttgacccg
gacccggcgctgccctggaaaagcatggtcgaggcgacgcagctcacgttatcggtgctc
gatgagctggggctcaaggcgttcctcaagaccagcggaggcaagggcatccatgtggtg
gtgccgctgacgcgcaagctgggttgggacgaggtcaaggggttcagccatgcgattgtc
agtcacatggccaagctgctgccggaccgtttttcggcggtgtccgggccgaagaatcgg
gtagggcggattttcatcgattacctgcgcaatgggttgggcgctaccaccatttgcgct
tacgccgcccggacccgggaagggttgccggtttcggtgcctgtttttcgtgaggaggtg
gccgagctcaagggggcgaatttgtggaatgtgcacaatgttcatgagcgtctggcggaa
gttgggcatgagccttgggcggggcttaagcggactcggcagagcattacggctgagatg
cgtaggcgtattggtatgagggagacggataagtag

DBGET integrated database retrieval system