KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a3413Help
Entry
PSEBR_a3413       CDS       T01472                                 

Definition
(GenBank) Thioredoxin-disulfide reductase (Alkyl hydroperoxide reductase, subunit F)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Brite
KEGG Orthology (KO) [BR:pba00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSEBR_a3413
Enzymes [BR:pba01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSEBR_a3413
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 DAO HI0933_like AlaDh_PNT_C FAD_oxidored Thi4 FAD_binding_3 NAD_binding_7 Glutaredoxin K_oxygenase NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: AEA69736
UniProt: F2KIE0
LinkDB All DBs
Position
complement(4216363..4217925)
Genome map
AA seq 520 aa AA seqDB search
MLDANLKAQLKSYLERVTQPIEIVASLDDGAKSQEMLALLQDVASLSHQITLLDNGSDAR
KPSFSLNRPGADISLRFAGIPMGHEFTSLVLALLQVGGHPSKASVDVIEQVRSLKGEFNF
ETYFSLSCQNCPDVVQALNLMAVLNPDIRHVAIDGALFQAEVDERQIMAVPSVYLNGVNF
GQGRMGLEEILAKIDTSGIERQAEKISAKDAFDVLVVGGGPAGASAAIYAARKGIRTGVA
AERFGGQVLDTMAIENFISVQETEGPKLAVALEEHVKQYDVDIMNLQRADALVPGKDGGL
HEIKFASGASLKAKTVILATGARWREMNVPGEQQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLLEFDVQLRADAVLQRKLHSLSNVKVITNAQTTEVTGDGQ
KVNGLRYKDRPSGDVRDVELEGIFVQIGLLPNTDWLKGTVELSPRGEIIVDARGETSIPG
VFAAGDVTTVPYKQIVIAVGEGAKASLSAFDHLIRTSAPA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgccaatcttaaagctcagttgaagtcatacctggaacgggtcacccagccg
atcgagatcgtcgcctccctcgacgacggtgcgaaatcccaggaaatgctcgcgttactc
caagacgttgccagtctttcccatcagattaccttgctcgacaacggcagcgatgcgcgc
aagccttcgttttcgttgaatcgcccgggagccgatatcagcctgcgttttgctggcatt
cccatgggccacgaattcacttcgctggtgttggccttgctgcaagttggcggtcaccct
tcaaaggccagtgtcgacgtcatcgaacaggtccgctccctcaagggcgagttcaacttc
gagacctatttctcgctgtcgtgccagaactgcccggacgtggtccaggcgctgaacctg
atggccgtactgaatccagacattcgccacgttgccatcgacggcgcgctgttccaggcc
gaagtcgatgaacgccagatcatggccgtgccgagtgtgtacctcaacggtgtgaacttc
ggccagggccgcatgggcctggaagagattctcgccaagatcgacaccagcggcatcgaa
cgccaggccgagaaaatcagcgccaaggacgcctttgatgtgctggtagtcggcggtggc
ccggccggtgcttcggcggcgatctacgcggcccgtaaaggcatccgcactggcgtggcg
gccgaacgtttcggcggccaggtgctcgacaccatggccatcgagaacttcatctcggtc
caggaaaccgaagggccgaaactggccgtcgccctggaagaacacgtcaagcagtacgat
gtggacatcatgaacctgcaacgtgccgacgccttggtgcctggcaaagacggcgggctg
catgaaatcaagttcgccagcggtgcgagcctcaaggccaagaccgtgatcctggcgacc
ggtgcccgctggcgcgaaatgaacgtgccgggcgagcagcagtatcgcaacaagggcgtg
gcgtactgcccgcactgcgacggtccgctgttcaagggcaagcgcgtggcggtgatcggc
ggtggtaactccggtgtcgaggcggccatcgacctggccggtatcgtcgcccacgtcacg
ttgctggagttcgatgtgcaattgcgtgccgacgcggtattgcagcgcaaactgcacagc
ctgtcgaacgtgaaggtgattaccaacgcccagaccaccgaagtgactggagacggtcag
aaggtcaatggcttgcgctacaaggaccgtccgagcggtgacgtgcgggatgtggagttg
gaggggatcttcgtgcagattggtctgttgcccaacaccgattggctcaaaggcactgtc
gagctgtcaccgcggggtgagattatcgtcgatgcccggggtgaaacctcgatccctggc
gtgttcgccgccggtgacgtgaccaccgtgccgtacaagcagatcgtgattgccgtaggc
gagggcgccaaggcttcgctgagtgctttcgaccacctgatccgaacctctgcgccggcc
tga

DBGET integrated database retrieval system