KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a4619Help
Entry
PSEBR_a4619       CDS       T01472                                 

Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00473  D-Alanine metabolism
pba00550  Peptidoglycan biosynthesis
pba01100  Metabolic pathways
pba01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:pba00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    PSEBR_a4619
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PSEBR_a4619
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    PSEBR_a4619
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:pba01011]
    PSEBR_a4619
Enzymes [BR:pba01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     PSEBR_a4619
Peptidoglycan biosynthesis and degradation proteins [BR:pba01011]
 Precursor biosynthesis
  Amino acid ligase
   PSEBR_a4619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 ATPgrasp_Ter RimK ATP-grasp_5 GARS_A ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-ProteinID: AEA71035
UniProt: F2K5A0
LinkDB All DBs
Position
complement(5620025..5620990)
Genome map
AA seq 321 aa AA seqDB search
MTAAYANLVSTLDPKAFGRVAVLFGGKSAEREVSLKSGNAVLQALQSAGVDAFGIDVGDD
FLQRLLSEKIDRAFIILHGRGGEDGSMQGLLECLGIPYTGSGILASALAMDKLRTKQVWH
SLGIPTPRHAVLASEADCISAATELGFPLIVKPAHEGSSIGMAKVNSLPELTAAWKDASS
YDSQVLVEQWITGPEFTIATLRDQVLPPIALGTPHTFYDYDAKYVANDTQYRIPCGLDAA
KEKELMDLTAKACEALGIAGWGRADVMQDADGQFWFLEVNTAPGMTDHSLVPMAARAAGL
DFQQLVVSILAASVGHQEPRG
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgactgctgcctacgccaacctggtctcgacccttgatccgaaagccttcggccgcgtt
gccgtgctgttcggcggcaagagcgccgagcgcgaggtgtccctcaagtccggcaatgcc
gtgctgcaagccctgcaaagcgccggtgtcgacgcattcggcatcgacgtgggcgacgac
ttcctgcagcgcctgctgagcgaaaagatcgaccgcgcattcatcatccttcatggtcgc
ggtggtgaagacggcagcatgcaaggtctgctcgaatgcctgggcattccctacaccggc
agcggcatcctggcttccgccctggcgatggacaagctgcgcaccaagcaggtctggcac
agtctcggcattccgacgccgcgtcacgccgtgctggcatccgaggccgattgtatttcg
gcggccacggaactgggcttccctttgatcgtcaaaccggcccatgaaggttcaagtatc
ggcatggcgaaagtgaattcgctgcctgagttgaccgcggcatggaaagacgccagttcc
tacgattcgcaagtgttggtcgaacaatggatcaccggtcccgagttcaccatcgccacc
ctgcgtgaccaggtattgcctccgattgcgctgggcacgccccacacgttctatgactac
gacgccaagtacgtcgccaacgatacccagtaccgcattccctgcgggctggacgccgcc
aaggaaaaagaactgatggacctcacggccaaggcctgtgaggcgctgggtatcgccggt
tggggcagggcagacgtgatgcaggacgccgatgggcagttctggttcctggaagtcaac
accgcgcctggcatgaccgaccacagcctggtgccaatggcggcgcgcgccgccggtctg
gatttccagcaactggtggtgtcgatcctggccgccagtgtcggccatcaagagccaaga
ggttaa

DBGET integrated database retrieval system