KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a4846Help
Entry
PSEBR_a4846       CDS       T01472                                 

Definition
(GenBank) Putative oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba00730  Thiamine metabolism
pba01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pba00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    PSEBR_a4846
Enzymes [BR:pba01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     PSEBR_a4846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 HI0933_like Pyr_redox_2 FAD_oxidored NAD_binding_8 FAD_binding_3 GIDA NAD_binding_9 Thi4 Pyr_redox Pyr_redox_3 ApbA UDPG_MGDP_dh_N 3HCDH_N NAD_binding_7 adh_short AlaDh_PNT_C Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: AEA71267
UniProt: F2KLF3
LinkDB All DBs
Position
complement(5874437..5875537)
Genome map
AA seq 366 aa AA seqDB search
MTRQQQVVIVGGGVIGLLTAFNLASEGQRVVLLDRSSVGQESSWAGGGIVSPLYPWRYSP
AITALAHWSQDFYPQLGERLFAATGIDPQVHVTGLYWLDLDDQDEALAWAEREGRPMRAV
DISAVHDAVPVLGAGFSRAIYMADVANVRNPRLVKSLKAALLAMPNVTLHEHCEVSGFIR
DGGRVVGVHSSAGEIRGDEVVLAAGAWSGELLKTLGLKLPVEPVKGQMILYKCASDFLSS
MVLAKGRYAIPRRDGHILVGSTLEREGFDKTPTDTALESLKASAQQLIPALAGAEVVGHW
AGLRPGSPEGIPYIGEVPGVAGLWLNCGHYRNGLVLAPASCQLFTDLMLGREPVIDPVPY
APAGRL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaccaggcaacagcaagtggtgattgtcggcggcggagtcattggcctgctgacggcg
ttcaatctggcgtccgaagggcagcgtgtggtgctgctggaccgttccagtgtcggtcag
gaatcgtcctgggccggcggcggtatcgtgtcgccgttgtacccctggcgctacagcccg
gcgatcacggcgctggcccattggtcgcaggatttttatccacagctgggcgagcgtttg
ttcgccgcgaccggaattgatccgcaggtgcatgtcaccggtctgtattggctggacctg
gacgatcaggacgaagcgctggcctgggccgagcgggaaggccgcccgatgcgggctgtg
gatatctcggcggtccacgatgccgtgccggtgctgggcgcgggtttttcccgggcgatc
tacatggccgacgtggccaacgtgcgcaatccccgattggtgaagtccctcaaggctgcc
ttgctggcgatgccgaacgtcacgcttcatgaacattgcgaagtcagtgggttcattcgc
gacggtgggcgtgtggtgggcgtgcacagttctgccggagaaattcgtggcgatgaggtg
gtactggccgccggtgcgtggagtggcgagttgctcaagaccttgggcttgaagttgccg
gtcgagccggtcaagggtcagatgattctgtacaagtgtgcgtcggattttctgtcgagc
atggtcctggccaaggggcgttatgcgattccgcgccgtgatgggcatattctggttggc
agtacgctggagcgtgagggcttcgacaagaccccgacggatactgcgttggagagcctg
aaggcttcggcgcagcagctgattccggcgctggcgggcgctgaggtggtcgggcattgg
gctgggttgcggcctggctcgcctgaaggcatcccctatatcggcgaggtgccgggggta
gcggggctgtggttgaactgtgggcattatcgcaatgggttggtgttggcgccggcgtcg
tgtcagttgtttacggatttgatgttggggcgtgagccggtgatcgatcctgtgccgtat
gcgccggctgggcgcttgtaa

DBGET integrated database retrieval system