KEGG   Pseudomonas brassicacearum subsp. brassicacearum NFM421: PSEBR_a5549Help
Entry
PSEBR_a5549       CDS       T01472                                 

Definition
(GenBank) putative serine/threonine protein kinase
  KO
K11912  serine/threonine-protein kinase PpkA [EC:2.7.11.1]
Organism
pba  Pseudomonas brassicacearum subsp. brassicacearum NFM421
Pathway
pba02025  Biofilm formation - Pseudomonas aeruginosa
pba03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:pba00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PSEBR_a5549
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    PSEBR_a5549
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pba01001]
    PSEBR_a5549
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pba02044]
    PSEBR_a5549
Enzymes [BR:pba01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     PSEBR_a5549
Protein kinases [BR:pba01001]
 Serine/threonine kinases: Other
  Bacterial family
   PSEBR_a5549
Secretion system [BR:pba02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   PSEBR_a5549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal VWA_2 TssR Kinase-like
Motif
Other DBs
NCBI-ProteinID: AEA72079
UniProt: F2K702
LinkDB All DBs
Position
complement(6687922..6691020)
Genome map
AA seq 1032 aa AA seqDB search
MSLTLNIVIPGYDIEGPIGEGAMASVYLATQRSLERKVALKVMAAALAADPTFCERFLRE
GKTLARLSHPHTVTIHDIGNVGELYYMAMEYLPNGTLKERIAAGLTPEQGLTYIRQIASA
LGYAHGLGLVHRDVKPANILFRADGTAVLSDFGIAKSLDDRTQFTQAGFAVGTPSYMSPE
QARGQDIDGRADLYALGVVLYEILVGKLPYTGNDALSTALAHLTEPLPELPVHHGRYQDV
LRKLLAKDPAERFPDAAALLRALDNLPDESAEATLIRPLSLQLPETPKPVDDLAGLTPMS
IDIPSGPAYSPPPPQSQPKPVAPPIKPPVQSSVSEQRKGPVFALAAVAVAVALALGGAGY
WWLSGDDGKDVKTPVATTTSVKPPEVKPPKTPEVPAVKPPVAPPAQPPVATEADGGQRPL
LMAGKKTLFQRVLSKPGAKLADAPGAAPGKALPAFSVLYVYQRKDVDGGSWVRVGAATDG
RSDGWLPAAQVSDWKQSLVLKFTERSGRAPVMFLRQPGDVEKLLANPSAAKNVLLKAQQS
PQDDQQVLALEPAASAVPQSQFYLLPIFDSRESLDENGQPVQLLNVASIDPGNTPKASSN
TPITTANADAFRTAVVLVVDTTVSMQPYIDQVRDVVHELQTRIAERGELDSVSFGMVGFR
SSIKKTPGLEYVAKTLITLEQGRDPQRFMELARQVKASTVSSHSFNEDAFAGVMEAVEGM
DWSGYGGRLILLVTDAGALRKNDPFAATQMNEAEVRQAALGKQIKIYALHLLSDAGKKTH
AGAQSQYRTLTADANPQIGDLYIPVPGADVRKFGERVDEIGSVFADLVHQVRSNKAQSVP
LLSAAPSLADKSAAVGYAMHMDFLGRKSASQAPQLVSAWTADRDLTNPALPAFQVCVMLT
KLQLNDLQQSLKLIVDAARKTQSSPKDFFQEIASASAYMSRDPSALRKGGNLADGGILGE
YLEGLPYRSKSLNMTQDLWLSLSVAEQEDFIDELDSKIRLYETFHNDLANWVRFGDAEPG
DALYRVPLSTLP
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgaccttgaacattgtcatccccggttacgacatcgaagggccgatcggcgaa
ggcgcgatggccagcgtgtacctggcgacccagcgttcgctggaacgcaaggtggcgttg
aaagtcatggccgccgcactggcggccgacccgaccttctgcgagcgttttttgcgcgaa
ggcaagacgctggcgcgcctgtcgcacccgcacaccgtcaccatccatgacatcggcaac
gtcggtgagctgtattacatggcgatggagtacctgcccaacggcacgctcaaggaacgc
atcgccgcgggcctgacgccggagcagggcctgacctacatccgccagatcgcctcggcc
ctgggttatgcccacgggctgggcctggtccaccgtgacgtcaagccggccaacatcctg
ttccgcgccgatggcacggcggtgctctcggacttcggcatcgccaagtccctggacgac
cgcacccagttcacccaggccggctttgccgtcggcacgcccagctacatgagcccggaa
caggcccgtggccaagacatcgacggccgcgccgacctgtatgccctgggcgtggtgctc
tacgaaatccttgttggcaaactgccgtataccggcaacgacgcactgtccacggccctg
gcacacctgaccgaaccgttgccggaactgccggtgcaccatggccgttaccaggacgtg
ttgcgcaagctgctggcgaaggatccggcggagcgtttcccggatgcggcggcgttgctg
cgggcgttggataacctgccagacgagtcggcggaagcgacgctgatccgaccgttgtcg
ttgcaactgccggagacgccgaaaccggtggatgacctggcgggtttgacgcccatgtcc
atcgacattcccagcggcccggcttattcaccaccgccgccacaatcgcagcccaagccc
gttgcgccgccgataaaaccgccggttcaatcctcggtgtcggagcaacgcaaggggccg
gtgttcgccctggctgccgttgcggtcgccgtggcgctggcgttgggtggcgcgggttat
tggtggttgtccggtgatgacggcaaagacgtgaagacgccagtggccacgaccacctcg
gtcaagccaccggaagtgaagccgccgaagacccctgaagtgccagcggtcaaaccaccc
gttgcccctccggctcagccacccgtggcgaccgaggccgatggtggccagcgtccgctg
ttgatggccggcaagaaaaccctgttccagcgcgtgctcagcaaaccgggggcgaagctc
gccgatgcgccgggcgccgcaccgggcaaggcgctgccggcgttttccgtgctgtacgtg
tatcagcgcaaggacgtcgacggcggttcgtgggtgcgggtcggcgccgccactgacggg
cgcagcgacggctggttgcccgccgcccaggtcagcgactggaagcagagcctggtgctc
aagttcaccgaacgttccggccgtgcgccggtgatgttcctgcgtcagcctggcgacgtg
gaaaagctcttggctaacccatcggccgccaagaacgtgttgctcaaggcccagcagagc
ccgcaggacgaccagcaagtgctggccctggagccggccgccagcgccgtgccgcagagc
cagttctatctgttgccgatcttcgattcccgcgagagcctcgatgaaaacggtcagccg
gtgcagttgctgaatgtcgcgtcgatcgatcctggcaataccccgaaggcgtcgagcaac
acgccgatcaccaccgccaatgccgacgcgttccgtaccgccgtggtgcttgtggtggac
accaccgtgtcgatgcagccctacatcgaccaggtgcgcgacgtggtccacgaactgcaa
acccgcatcgccgagcgcggcgagttggatagtgtcagcttcggcatggtgggtttccgc
agcagcatcaagaagactccaggcctggaatacgtcgccaagaccttgatcaccctggag
caggggcgcgacccgcaacgcttcatggagctggcgcgtcaggtcaaggcatcgacggtg
tcgagccattcgttcaacgaagatgcgtttgccggggtcatggaagccgtcgaaggcatg
gactggtccggttacggcgggcgtttgatcctgttggtcaccgacgccggggccctgcgc
aagaacgatccatttgccgccacgcaaatgaacgaggccgaagtgcgccaggccgcactg
ggcaagcagatcaagatctacgccttgcacctgctcagcgacgccggcaagaaaacccat
gccggcgctcagagccagtaccgcaccctgaccgccgacgccaacccgcagatcggtgac
ctgtacattccggtgccgggcgccgacgtgcgcaagttcggcgagcgcgtcgacgagatc
ggttcggtgtttgccgacctggtgcatcaggtgcgcagcaacaaggcgcaaagcgtgccg
ctgttgagtgccgcgccgagcctggccgacaagtcggccgcggtcggctacgcgatgcac
atggactttttggggcgtaaatccgccagccaggcgccgcaactggtcagcgcctggacc
gccgaccgcgacctgaccaacccggcactgccggcgttccaggtctgcgtgatgctgacc
aagctgcaactcaacgacctgcagcagtcgctgaagctgatcgtcgacgcggcccgcaag
acccagagttcgcccaaggatttcttccaggaaatcgccagcgccagtgcctacatgagc
cgcgacccgtcggccctgcgcaagggcggcaacttggccgacggcgggattctcggcgag
tacctcgaagggctgccgtaccgcagcaagtcgctgaacatgacccaggatctgtggctg
tccttgagcgtggccgagcaggaagatttcatcgacgagctggattcgaaaatccgcctc
tacgaaaccttccacaacgacctcgccaactgggtgcgcttcggcgatgccgagccgggt
gacgccttgtaccgcgttccattgtcgacgctgccgtga

DBGET integrated database retrieval system