KEGG   Pogonomyrmex barbatus (red harvester ant): 105423690Help
Entry
105423690         CDS       T04903                                 

Definition
(RefSeq) angiotensin-converting enzyme-like
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:pbar01002]
    105423690
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbar04147]
    105423690
   04090 CD Molecules [BR:pbar04090]
    105423690
Enzymes [BR:pbar01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     105423690
Peptidases [BR:pbar01002]
 Metallo Peptidases
  Family M2
   105423690
Exosome [BR:pbar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105423690
CD molecules [BR:pbar04090]
 Proteins
  105423690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 105423690
NCBI-ProteinID: XP_011631849
LinkDB All DBs
Position
Unknown
AA seq 643 aa AA seqDB search
MLRLILIAAVITLVIAKPTSEDAVNISKNLQTADDLLKSAQEILKRLDAQYAEWSNKQSI
AGWNYASNLTDANLAEKLKVSAEAARVSKQMAQEVNSFSWRDLEDESLKRQFKKLGVLGT
AALPEDSYKEFETTISQMENIYSTAKICDYNNKSKCDLALEPEITELLMRSRDPEELKHI
WVEWRKASGEKVKSLYPKYVELANTAARLNNFSDYAAYWMKDYEADDFPDQIENQWQQLK
PLYVQLHAYVRRELRKKYGEDIISKDGPIPAHLLGNTWAQTWANIADFTVPFPGKQLPDV
SAALVEQGYNATSMFRLAEDFFTSINLTAMPDTFWENSILTKQKGVDMICHASAWDFYDG
KDFRIKQCTRVNMEDLLTAHHEMGHIEYYLQYKDQPTVFKEGANPGFHEAVGDVISLSAS
TPSHLKKIGLLKDDSTDREALLNHLYVKSLDKIAFLPFAYMMDRWRWNVFQGKVTPDNYN
CHWWSLAEEYQGIEPPIDRSEEDFDPGSKYHIIADVEYIRYYVSFVIQFQFHKALCTKAK
QYDPNNPEAKPLHQCDIYDNKDAGNLLKSMLEFGSSKPWPNAMEKISGQQQMDSAGLLEY
FKPLTDWLTEENKKTNEYIGWNPTKRQCVQTREELRTVTEPSE
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctaatcctgatagcagcagttataactctggtgatagccaaaccaacatcg
gaggatgcagtgaatatcagtaaaaatctgcagactgccgatgatcttctgaaatccgcc
caagagatcctgaaacgccttgatgcacagtacgctgaatggagtaataaacagagcatc
gcaggatggaattacgcgtcaaatctgacggatgcgaacttggcagagaagctgaaggtg
tctgcagaagcggcgcgcgtctctaagcaaatggcccaggaagtgaattccttttcttgg
agagacttggaagacgaaagcctcaagaggcaattcaagaaacttggtgtacttggcacc
gccgctcttcctgaagacagttacaaggaattcgagacgacgattagtcaaatggagaac
atctatagcaccgcgaaaatctgtgattacaataacaagagcaagtgcgaccttgcactc
gaaccagagattaccgagttgctgatgcgcagtcgagatcctgaggaattgaagcatatc
tgggtggaatggcggaaggcgtcgggcgagaaagtcaagtctctgtaccccaagtatgtc
gagctagccaacactgcggcgagactcaacaacttctccgattacgcggcatattggatg
aaggattatgaagctgatgatttccctgatcaaatcgaaaatcaatggcaacaattgaag
ccgttgtatgtacaactgcatgcctatgtacggcgcgagctcaggaagaaatatggcgag
gacatcatctctaaggacggcccgattccggcgcatctgttgggcaacacgtgggcgcag
acttgggcgaatatcgccgacttcactgtgccattcccgggcaagcagctgccggacgtt
agcgccgctttagtagaacaaggatacaatgcgacgagcatgttccgcctcgctgaggat
ttcttcacgtcaatcaacttgactgccatgccggatacattctgggagaattcgatcttg
acgaagcagaaaggtgtagatatgatctgccacgcgagtgcatgggacttctatgacggc
aaggatttcaggatcaagcagtgtacgcgtgttaatatggaggacttgttgacagctcat
cacgagatgggtcatattgagtattatctacaatacaaggatcaacctacagtcttcaaa
gagggcgcgaatccaggctttcatgaggcggttggtgatgttatatctcttagtgcgtcc
actcctagtcatctcaagaagatcggtctactaaaagacgactcaactgaccgggaggca
cttcttaatcacctttatgtgaagagtcttgataagatcgcctttctgccatttgcttat
atgatggatcggtggcgttggaatgtattccagggaaaagttacacccgacaattacaac
tgtcactggtggtcacttgcggaggaatatcaaggtatcgaacctcccatagatagatcg
gaagaagacttcgatcctggttcgaagtaccacataatcgcagatgtcgagtacataaga
tattacgtaagcttcgtaattcaattccaattccataaggcattgtgtactaaagctaag
caatacgatccaaacaatccagaagccaaaccattgcatcaatgtgatatttatgataac
aaggatgctggaaatctgctgaaatctatgctggaatttggttcctcaaaaccatggcca
aatgcgatggagaaaatctcaggtcaacaacagatggattcggctggacttttggaatac
tttaagcccctgactgattggctgactgaagaaaacaagaaaactaatgagtacattgga
tggaaccccactaagagacaatgtgtacaaacgagagaagagcttagaacagtcactgaa
ccttcagaataa

DBGET integrated database retrieval system