KEGG   Pogonomyrmex barbatus (red harvester ant): 105424715Help
Entry
105424715         CDS       T04903                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00020  Citrate cycle (TCA cycle)
pbar00190  Oxidative phosphorylation
pbar01100  Metabolic pathways
pbar01200  Carbon metabolism
Module
pbar_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pbar_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pbar_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105424715
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105424715
Enzymes [BR:pbar01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105424715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-GeneID: 105424715
NCBI-ProteinID: XP_011633400
LinkDB All DBs
Position
Unknown
AA seq 662 aa AA seqDB search
MSGLLKLSASLLPRGLPGAATLNKLGLPLLGNRKIHHTPDRTAKISNEISKQYPLVDHTY
DAVVVGAGGAGLRAAYGLVAEGFKTAVVTKLFPTRSHTVAAQGGINAALGNMEDDNWQWH
MYDTVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTSDGKIYQRAFGGQSLKFGK
GGQAHRCCCVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLLMEDGECRGVIALCLEDG
TLHRLHAKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVSRANLPNQDLEFVQFHPTGIYG
AGCLITEGSRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRSMTMEIREGRGVGPEKD
HIYLQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVIPTVHYNMGGVPTNYKGQVL
IRENNQDRVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACAKTIAQENKPGEAIG
PLKPNAGEETVANLDWVRNANGSISTAELRLTMQKTMQTHAAVFRDAESLQEGCRKMTDL
YKKLDELKVADKSLIWNSDLIETLELQNLMINAMQTIVGAEKRKESRGAHAREDFKQRID
EYDYSKPIENQQPKSLDQHWRKHTLSKINPRTGEVSLDYRPVIDTTLNQEECATVPPAIR
SY
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtctactgaagctgtcggcgtcgttgctgccgaggggtctgcctggggcggcg
acgttgaacaagctgggactgccgctcctcggtaaccgcaagattcaccacacgccggac
cgaacggccaagatctctaacgagatctccaagcagtaccccttggtggaccacacgtat
gacgcggtggtggtgggagccggcggtgccgggttacgcgcggcctacggcctcgtggcc
gagggcttcaagaccgcggtggtcaccaagctgttcccaacgaggtcgcacacggtcgcc
gcccagggtggcatcaacgccgctctgggcaacatggaggatgacaattggcagtggcac
atgtacgacaccgtcaaaggctcggactggctgggcgaccaggatgccattcattacatg
acccgcgaggcaccgaaggccgtcatcgagctggaaaactgcggcatgcctttcagccgc
accagcgacggcaagatctatcaacgcgcctttggtggtcaatccctcaagttcggcaag
ggtggccaagctcatcgatgctgttgcgtagccgacagaaccggccactcgctgctgcac
acattatatggccaatcattgagctacgactgcaactatttcgtcgaatacttcgcgctt
gatttgctgatggaagatggcgaatgtcgtggtgtgattgcgctctgcctagaggatggc
acgctacatcgtcttcacgctaagaacacggtgcttgccaccggtggttacggacgcgct
tatttctcgtgcacgtctgcgcatacctgcaccggagacggcactgccatggtctccaga
gccaatctgcctaatcaagacttggaatttgtacaatttcatcctacaggtatttacggt
gccggatgcctgattacggaaggtagtcgcggtgaaggtggctatctaataaacagtgag
ggcgagagattcatggagcgttacgcgccggtagcaaaagatctagcatcacgagacgtg
gtgtctagatccatgacaatggagatcagggaaggcagaggcgtcggaccggagaaggat
catatttatctgcagctacatcatctgccacctgaacagctggctgcacgattacctggg
atttctgagacggcgatgatattcgctggcgtcgacgtgacccgagaacctatccccgtc
ataccaactgttcattacaatatgggaggtgtaccgacgaattacaaaggtcaggtatta
atcagggagaacaatcaagacagagtagtacctggattgtatgcatgcggtgaagcagct
tgtgcatccgttcacggcgccaatcgtctaggtgccaattctttattggatttagttgta
ttcggacgtgcttgcgctaaaactatcgcccaagaaaacaagcctggtgaggcaatcgga
cctttgaaacccaatgctggcgaggagactgtagctaatttagattgggttagaaacgcc
aatggctctatttctactgcggaattgaggctgactatgcaaaaaactatgcagacacat
gcagccgtcttcagagatgccgaaagcttgcaagaaggctgtcggaagatgactgatctc
tataagaaactggacgagctaaaggtcgcagacaaatctttaatatggaactccgatcta
atagagacgctcgaactgcaaaatctcatgatcaacgcgatgcagactatcgtgggggcc
gagaagagaaaggagagtcgcggcgcgcacgctcgcgaggattttaagcaaagaatcgat
gagtacgactatagtaaaccgatcgagaatcaacagccaaagtcgctcgatcaacattgg
aggaagcacacactgtcaaagatcaatccgagaacaggagaggtgtctctcgactataga
ccagttatcgatactacactcaatcaagaggaatgcgcgacagtcccgccagcgattcgt
tcctattaa

DBGET integrated database retrieval system