KEGG   Pogonomyrmex barbatus (red harvester ant): 105425920Help
Entry
105425920         CDS       T04903                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00010  Glycolysis / Gluconeogenesis
pbar00030  Pentose phosphate pathway
pbar00051  Fructose and mannose metabolism
pbar00052  Galactose metabolism
pbar01100  Metabolic pathways
pbar01200  Carbon metabolism
pbar01230  Biosynthesis of amino acids
pbar03018  RNA degradation
Module
pbar_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105425920
   00030 Pentose phosphate pathway
    105425920
   00051 Fructose and mannose metabolism
    105425920
   00052 Galactose metabolism
    105425920
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    105425920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pbar01009]
    105425920
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pbar03019]
    105425920
Enzymes [BR:pbar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     105425920
Protein phosphatases and associated proteins [BR:pbar01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     105425920
Messenger RNA biogenesis [BR:pbar03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     105425920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 105425920
NCBI-ProteinID: XP_011635231
LinkDB All DBs
Position
Unknown
AA seq 813 aa AA seqDB search
MDCYQHHQSYKEYCDTVMAEDTPAQKFIRPGSHKGKGIAVFTSGGDSQGMNAAVRAVVRM
GIYLGCRVYFIREGYQGMVDGGKNIEEATWSSVSCIIHRGGTVIGSARCSEFRERPGRRK
AAKNLVNLGITNLVVIGGDGSLTGANLFKEEWPTLLKELVESGDITAEQSEKYKQLHIVG
LVGSIDNDFCGTDMTIGTDSALHRIIESIDAIVSTAYSHQRTFIMEVMGRHCGYLALVAA
ICCEADYVFIPEWPPEQDWPNKLCKKLLQERLTGQRLNIIIVAEGAVDRNGDPITADKVH
KVVVEKLQQDTRVTVLGHVQRGGNPSAFDRVLGCRMGAEAVMALMEATPDTEACVVTLDG
NQAVRLPLMECVRRTKAVAQAMADKNWNLAVQLRGKGFERNLDTYKMLTRLKAPDLDDNR
EVSGRALSKDHYTLAVMHIGSPSCGMNAAVRSFVRNCIYRGDKVYGVYDGVLGLIAGKLK
LMDWPSVTGWVAEGGAKLGTKRAPPQEDQLSQIAQKLKEFGIQALLIIGGFEGYQTGLTF
FKARDKYEEFRIPIAMIPATISNNVPGTEFSLGCDTALNEITEICDRIRQSAQGTKRRVF
IIETMGGFCGYLATVAGLAGGADAAYIYEEKFNIKDLNHDVIAMAAKMSEGVERGLIIRN
ENANENYNTEFMFRLFSEEGKGLFSCRRNILGHMQQGGSPTPFDRNLGTKMGAKAVEWFS
DQLRKCTSPDGKTLTMAADSAVMLGIVRRQYRYTPFMELIDVTDFEHRIPTYQWWMKLRP
LLKVLAKHESTYEEEGLYITVEEMDEQKDPPLV
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggattgttatcagcatcatcagagttacaaggaatactgcgatacagtcatggctgaa
gacacgccagctcagaaatttataagacctgggagccacaaaggcaaaggcatcgccgtg
ttcaccagtggaggcgattctcagggaatgaatgccgctgtacgagcagttgtaaggatg
ggcatctatcttgggtgcagggtatattttatccgggaaggctatcaaggcatggtggac
ggcgggaaaaatatcgaggaagctacatggtcgtccgtgtcttgcatcattcataggggt
ggtacggtaattggctctgcccggtgctcagaattcagggagcgtcccggtcgtcgaaaa
gctgccaagaatctggttaacctggggataaccaatctagtggtaattggcggggacggt
tctcttacgggggccaatctcttcaaagaagagtggcccacgcttctgaaggagcttgtc
gagtctggtgacataactgccgagcagagcgagaaatacaagcagttgcacattgtcggt
ctagtaggttccattgataacgatttctgcggtacggatatgacgatcggtaccgattcc
gcgttgcatcgtatcattgagagtattgatgctatagttagcacggcgtattcgcatcag
agaacgttcataatggaagttatgggtcgtcattgtggttatctggctctggtggcagct
atatgttgtgaggctgattatgttttcatcccagaatggccacccgagcaagattggccc
aacaagctgtgcaaaaaattgttgcaggaaagacttactggtcagcggcttaatattata
atcgtagccgaaggggcagttgacagaaatggcgatccgatcactgctgacaaagtgcac
aaagtagttgtagaaaaattacagcaagatacaagagttaccgttttgggtcatgtacaa
agaggtggcaatccttctgcctttgatagagtcctgggttgccgaatgggagctgaagcg
gtgatggctttaatggaggcgacacctgatacggaagcctgtgtcgttacgttggacggt
aaccaagctgtgagattaccacttatggaatgtgttcgtcgtacaaaagctgtagcgcaa
gcaatggccgataaaaactggaatcttgctgttcagcttcgaggaaagggcttcgaacgc
aacttagatacttacaaaatgctgactcgtttgaaagcgccggatttggatgataacagg
gaagttagtggccgcgcattatcgaaggatcattacacgttggcggtcatgcatatagga
tcgccgtcttgcggtatgaatgcggcggttcgttccttcgtgaggaattgtatctaccga
ggtgacaaggtatacggtgtttacgacggagtactgggcctcattgctggtaaattgaaa
ttgatggattggccgtccgtcactggctgggtcgcggagggtggcgcaaaactaggaacg
aagcgcgcaccgccccaggaggatcagttatcccaaatcgctcaaaaactcaaggaattt
ggaatacaggcattgcttatcataggtggatttgagggttatcaaaccggcctcacattt
ttcaaagcgagggataaatacgaggaattcagaattcctatcgctatgatccctgcgact
attagcaataatgtaccaggcactgaattttccttgggctgtgatacagctctaaatgaa
attactgagatatgcgatcgcattcgacaatcggcgcaaggtactaaacgtcgagtattc
atcattgagacgatgggtggtttttgcggatatttggcgacagtcgctggtctagctggc
ggtgctgacgcggcgtatatatatgaagagaaatttaacattaaggatctgaatcatgat
gttatcgcgatggctgcaaagatgtcggaaggcgtcgagagaggtctcattatcagaaac
gagaatgctaatgaaaattacaacacggagtttatgttcagacttttcagtgaggaagga
aaaggattattcagttgtagaaggaacatacttggtcacatgcagcaaggtggctcgccg
acgcctttcgaccgtaacttgggaacaaaaatgggcgctaaggcagtggaatggtttagc
gatcaactgagaaaatgcactagccccgatggcaagacgctcactatggcagcagacagt
gcagtaatgcttggtattgtcagacgccaatacagatatacaccattcatggaacttatc
gacgttactgattttgaacatcgcattccgacgtaccaatggtggatgaaactgcgtccg
ttgctgaaagtattagcgaagcacgagtcgacatacgaagaggaaggcctgtatataacc
gtcgaagagatggatgagcaaaaggatccgccccttgtataa

DBGET integrated database retrieval system