KEGG   Pogonomyrmex barbatus (red harvester ant): 105428305
Entry
105428305         CDS       T04903                                 

Definition
(RefSeq) uncharacterized protein LOC105428305
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    105428305
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 105428305
NCBI-ProteinID: XP_011638846
UniProt: A0A6I9X366
LinkDB
Position
Unknown
AA seq 124 aa
MMDNQLKNDRVRKVCKKLFQDDDDDNNEQQKHCDIRESILEEMRIQAERDEKKWNFNFIH
EKPLPGRYEWVGPNDEIPEENEISDFKETNERIQNDQEEYAEETKNNAENIYNKSNENDA
ERSN
NT seq 375 nt   +upstreamnt  +downstreamnt
atgatggataatcaattgaaaaatgatcgagtccgtaaggtatgtaaaaaactttttcaa
gatgatgatgatgataataacgagcaacaaaaacactgtgacattcgtgaaagtatatta
gaagaaatgcgaatacaagcagaacgggatgagaagaagtggaactttaatttcatacac
gaaaagccattgcctgggcgttacgagtgggtaggaccaaatgatgaaattcctgaagaa
aatgaaatttctgacttcaaggagacaaatgaaaggatacaaaatgatcaggaagaatat
gcggaggagacaaaaaacaatgcggaaaatatatataataaatcgaatgaaaacgatgca
gaaagatcaaattag

DBGET integrated database retrieval system