KEGG   Pogonomyrmex barbatus (red harvester ant): 105429028Help
Entry
105429028         CDS       T04903                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00052  Galactose metabolism
pbar00500  Starch and sucrose metabolism
pbar01100  Metabolic pathways
pbar04142  Lysosome
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105429028
   00500 Starch and sucrose metabolism
    105429028
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105429028
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pbar04147]
    105429028
Enzymes [BR:pbar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105429028
Exosome [BR:pbar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105429028
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110 Ehbp
Motif
Other DBs
NCBI-GeneID: 105429028
NCBI-ProteinID: XP_011639981
LinkDB All DBs
Position
Unknown
AA seq 1033 aa AA seqDB search
MADVEPNEQNTSKKSNSNNIAAKFKTIVVRELNNETYRPLTKENHERKKKLDKLFSRDNN
SQKWIITILFFGVIFAFLYFLCPSVLDRFMNSSTTVSYNEKVEFVIDINNDTIEETRYQH
ILMDTPDMHIIQEKYDYEIVPLTKESDLSEKDTVLNSAQCINIPEVLRFDCHPEAGASQL
SCTDRGCCWNPPKRNELEKHVPLNIPYCYYPEEWNLYKYTNYSQDGNNFSGFLSRKRESM
YKNNVPLVKVEATSIDSSILRVKIYDPLKARYEPPWPIRSDPKPFLSQVTNTKYQFYSDG
IQPGFKINRINDGTTLFNSLGFGGFIFADQFLQISALLPTNNIYGIGEHRSSLKLNTNWQ
SFTLFNKDQPPTENANLYGSHPFYMVIEESGMAHGVLFLNSNAMDVILQPTPAITFRTIG
GIFDIYFFLGPTPADVVKQYSDIVDKPFMPPYWSLGFHLCRFGYKTLEKTKAVWNRTRAA
GIPFDTQWNDLDYMEKNNDFTYNKEKFKDLPKFVEEIHSVGMHYVPLIDAGISASENNGS
YPPYDEGIKQNIFVKDGISHKPFIGKVWNFVSTVWPDFTNPKTLIYYADMMSNMHKSFAY
DGAWIDMNEPSNFYNGHKDGCTHNNLDYPDYLPNVVGNLLATKTLCMNAEHYLGSHYDLH
NTYGTSQAIATNYALRKIRLKRPFIISRSTWIGHGHYAGHWTGDVYSSWHDLKMSIPAIL
SLNFYQIPMVGADICGFDGNTTAALCNRWMQLGAFYPFSRNHNSDTTIEQDPVAMGDLVV
KSSKNALKIRYRLLPYLYTLFFRAHKFGETVARPLFFEFTDDRQTYDIDTQFLWGNALMI
NPVLEENKIEIPVYVPRGMWYDYYTIRSFFSIGKHYTLPAPLDRIPLLVRGGSILPTQKP
GVTTTESRKNDFELIVVLNEAGDAKGELYWDDGDSLDSIKKKEYLWLSFTANKSNLLSTE
VNKGSYNEEVILGAVQIWGLRQQVSRVFLNENEIGFKYNVFTSILDITGLQVDMRQPFTF
YWILQETNDRQYY
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgtagaaccaaatgagcaaaatacttctaaaaaatcaaattcaaacaatatt
gcggcaaaattcaaaaccattgtagttagagaattaaataatgaaacatataggccacta
acaaaagaaaatcatgaaagaaaaaagaagcttgataaactattcagtcgtgataataac
agtcagaaatggataataacaatcttattttttggcgttatattcgcgtttctatatttt
ctctgtccttcggtattagacagatttatgaattcaagcactactgtgagttataatgag
aaagtggaatttgtgattgatataaacaatgatactattgaagaaacaagataccagcat
atattaatggatactcctgatatgcacatcatacaagaaaaatatgattacgaaatagtg
cctttaactaaggaaagcgacctatctgaaaaagacacagtcttaaacagtgctcaatgc
atcaatattcctgaggtattgcgttttgattgtcatccagaggctggagcctcgcaactc
tcctgtacagatagaggatgctgttggaatcctcctaagagaaatgaattagaaaaacat
gtgccactaaatattccttattgttactatcctgaagaatggaatctgtacaaatacact
aactatagtcaggatggtaataatttttcaggttttctcagtcggaagagggaatctatg
tacaagaataatgtgcctctggtaaaagtggaagccacgagcatagatagttcaattctg
cgagtaaagatatatgatcctttgaaagcacgatatgaacctccatggccgattagatcg
gatccgaaaccatttttatctcaagttactaacacaaaatatcagttttatagcgacggt
atacaacctggctttaagattaatagaattaatgatggcactacattatttaattctctt
ggatttggaggttttatatttgctgatcaatttttacaaataagcgcattgctaccaaca
aacaatatttatggcatcggcgaacatagatcaagtttaaaattgaatactaattggcaa
tcattcactctattcaataaagatcaaccaccaacagaaaatgcaaatttatatggatct
catccgttttatatggtgatagaggaatctggaatggctcatggagttttatttttaaac
agtaatgccatggatgtaatattacaacctacaccagctataacgtttaggacaatcggt
ggtatctttgatatttatttctttctcggaccaactccagccgatgtagtgaaacaatat
tccgatatcgtagacaaaccgtttatgccaccctattggtcacttggtttccatttatgc
agatttggatataaaacattggaaaagactaaggcggtatggaacagaacaagagccgct
ggaatcccatttgatactcagtggaatgatctggattatatggaaaaaaataatgatttt
acatataataaagaaaagtttaaagatttgcctaaatttgtagaagaaattcactcggta
ggaatgcattatgtccctttaatagatgctggcatatccgcttctgaaaataatggttcc
tatccgccctacgacgaaggaataaagcagaacatatttgtaaaagatggtatatcccat
aaacctttcatcggcaaagtctggaattttgtttctactgtatggcctgacttcacgaac
cctaaaaccctaatctattatgcagatatgatgagcaatatgcataaaagtttcgcatat
gacggtgcatggatcgatatgaacgaaccatctaatttctataatggtcataaagatggc
tgtacacataataacttggattatcctgattatttacccaatgtcgttggtaatcttctc
gctacgaaaactctttgtatgaatgccgaacattatttaggttctcattatgatcttcac
aatacttacggaacgagccaagcgattgccacgaattatgcccttagaaagattagacta
aaaagaccgtttataatatcgcgttcgacatggataggacatggccattatgcgggtcat
tggacaggagatgtttattcatcatggcatgatttaaaaatgagtattccagccatttta
tcactcaatttctatcaaattccaatggtgggtgcagatatttgcggttttgacgggaac
acaactgctgctttgtgcaatcgttggatgcaacttggtgccttttatccattttctcga
aatcataattccgatactacaattgaacaagatccagttgctatgggtgatttagtcgta
aaatcatcaaaaaatgctttgaaaatacgttaccggttgctaccgtatttgtatacctta
tttttcagagcacataaatttggggaaacagtagcacgtccattatttttcgagttcacc
gatgaccggcagacttatgatattgatacgcaatttctttggggaaatgcacttatgatt
aatccagttctcgaagagaacaagattgaaatacctgtttatgtaccacgtggaatgtgg
tacgattattatactattaggtcctttttctctatcggaaaacattatacattacctgca
ccacttgatagaataccattattagttcgtggaggctcaatacttccaacacaaaaaccg
ggtgtaacgacgacagagagcagaaagaatgattttgaattaatagtagtattaaatgag
gctggggatgctaaaggagaactatattgggacgatggtgatagtttagattctataaaa
aagaaagaatatttgtggttgtctttcactgcaaacaaatccaatttattaagcacagaa
gtaaataaaggttcttataatgaagaagtaattcttggagcagtacaaatttggggattg
cgacaacaagtttctagagtattcctaaatgaaaatgaaataggatttaaatacaatgtc
tttacatcgattctagatattactggcttgcaagtggatatgagacaaccatttacattt
tattggatacttcaagaaaccaatgacagacaatattattaa

DBGET integrated database retrieval system