KEGG   Pogonomyrmex barbatus (red harvester ant): 105431443Help
Entry
105431443         CDS       T04903                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00040  Pentose and glucuronate interconversions
pbar00051  Fructose and mannose metabolism
pbar01100  Metabolic pathways
Module
pbar_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    105431443
   00051 Fructose and mannose metabolism
    105431443
Enzymes [BR:pbar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     105431443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Methyltransf_16 Pyr_redox_3 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 105431443
NCBI-ProteinID: XP_011643927
LinkDB All DBs
Position
Unknown
AA seq 350 aa AA seqDB search
MAKDNLTAVLYGINDLRLENTSIEEPGDNEVLLEMGCVGICGSEIHYFVNGRIGDFIVKK
PMIVGHEASGTVIKLGNNVKNLKIGDRVAIEPGVPCKMCVFCKEGRYNLCKDIVFCATPP
VHGNLRRFYKHAADFCFKLPDHVSLEEGALLEPLSVGVHACKRGGVGINSKVLILGAGPI
GLVTLLVAKAMGANKVVITDIMECKLNIAKKLGADDTYLVQKDRSEKDMVADIHAIFGDE
PNKTIDASGAQASIRLAILATKSGGVVVLVGMGPPEVQVPLINALVREVDIRGVFRYVND
YSDALALIASGRVNVKPLITHNYKMEEIKQAFETTRTGAGGAIKVMIHCK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggacaatcttaccgctgtactgtatggcatcaatgacttacgcctggaaaat
acaagtatcgaggaacctggagataatgaggtactcttggaaatgggatgcgtaggaatt
tgtgggtcggaaattcattattttgttaatggcagaatcggcgatttcatagtgaaaaaa
cccatgattgtcggtcatgaggcttctggtaccgttatcaagcttggaaataatgtcaag
aacttaaagatcggcgatcgtgttgccatcgaacctggtgtaccctgcaagatgtgcgtg
ttctgcaaagagggacgttataatctgtgcaaggatatagtattttgtgcaactccgcct
gtacacggcaatttaagacgcttttataaacacgcagctgatttctgcttcaagttaccc
gatcacgtgagtttagaggaaggagcgcttttagagccattgtcagtaggagtacacgct
tgcaaacggggcggggtcggtatcaattctaaagtattaattctgggagctggaccgatc
ggtttggtgacgttgctagtagccaaagccatgggcgcgaacaaagtagtcatcacggat
attatggaatgtaaactaaatatagcgaagaaacttggcgccgacgacacatatttggtg
caaaaggatagatcggagaaggatatggtggctgacattcatgcaatttttggggatgaa
cctaacaagacgatagacgcttccggtgcacaagcttcgattcgtttagcaattcttgcg
acaaaatctggtggagttgtagtattagttggaatgggtcctccagaggtgcaagttccg
ttaataaatgctttggtcagagaagtcgacatccgaggtgttttccgatatgtaaatgac
tatagtgatgcattggctctcatcgcatctggcagagtaaacgtgaagccgttgattact
cataattacaaaatggaggagattaaacaagcattcgaaaccactagaactggagcggga
ggagctattaaagttatgattcattgtaaataa

DBGET integrated database retrieval system