KEGG   Pogonomyrmex barbatus (red harvester ant): 105431533Help
Entry
105431533         CDS       T04903                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00052  Galactose metabolism
pbar00500  Starch and sucrose metabolism
pbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105431533
   00500 Starch and sucrose metabolism
    105431533
Enzymes [BR:pbar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105431533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 105431533
NCBI-ProteinID: XP_011644078
LinkDB All DBs
Position
Unknown
AA seq 573 aa AA seqDB search
MNIILTLCAVLLSSNLGYCENNPEWWKTMSLYQIYPRSFKDSDGDGVGDLKGITSKLGHL
VEANVDAFWLSPIYPSPMVDFGYDISDFVNIDETFGTMKDFEELVKAAHDVSIKVIMDFV
PNHSSNKHEWFEKSVKSIEPYTNYYVWHKGKVLTNGTVMAPNNWVSVFGGPAWTWSEERK
AYYLHQFAPEQPDLNYENEEVVNAMKDVLRFWLNKGVDGFRIDAVPHLCEDVRFLDEPLT
GNPNPNDYGYTDKIYTKDQPRTYEIVKGWRKVLDEYQDQKVMMIEAYANMTMTMKYYIYG
AHFPFNFALITDTNRDSKASDFKRLIDKWMVNMPVLGGTPNWVAGNHDKSRLVTRYGRQR
AESVTMMTLLLPGIGVTYNGEEIGMEDTWISWEDTKDPQGCNAGKEGYEKASRDPARTPF
QWDNTTSAGFSTNPKTWLPVNKNYLTLNLAAQKEGNTHNSYYKLYIRTSDLRKKPAFKFG
SLTTRLLNNNVLSLTRRFSNSTFTQVIYVAVNFADKEETVDLSMLDDEPNELNVYYASSN
SQHLIGNIDDIHALKIPASGSVICTNINTDKTR
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgaatattatactaacactttgcgcggtattattatcatccaatctcggttattgtgaa
aataatccagaatggtggaagacaatgtctctttatcaaatttatcccagaagtttcaaa
gatagtgatggtgatggtgtcggagatcttaaaggtatcacgagcaaattaggccatctc
gttgaagcaaatgtcgatgctttctggttatctccgatttatcctagtccaatggtggat
ttcggctatgacatttctgattttgtcaacatcgacgagacatttggcaccatgaaagat
ttcgaagagcttgtaaaagccgcacacgacgtatccataaaagtcatcatggattttgtc
cctaatcactcgtcaaataagcacgaatggttcgaaaagagtgtgaaaagcatagaaccg
tataccaactactatgtgtggcacaagggcaaggtattaacgaatggaactgttatggca
ccgaataattgggtaagtgtattcggtggaccagcatggacttggtctgaagaacgaaaa
gcatattatttgcatcaatttgcaccagaacagcctgatctcaattatgaaaacgaggaa
gtagtaaacgcaatgaaggatgtcttaagattttggctcaataagggagtggatggattt
cgaatagatgcggtaccacatttgtgtgaggacgttagattcttggacgagccactcacg
ggtaacccaaatcctaatgattacggttacacagataaaatatacacaaaagatcagccg
cgaacctacgaaatagtcaaaggatggcgaaaagtactggatgagtaccaagaccaaaaa
gttatgatgatcgaagcttacgcaaacatgacgatgacaatgaaatattatatatatggt
gcacactttcccttcaattttgctttgatcactgatacgaatcgagattcgaaagcaagc
gatttcaagagactgatcgacaaatggatggtgaacatgcctgttttgggaggaactcct
aattgggtggctggaaatcatgataaatcaagattagtcactcgttacggacggcaacga
gctgaatctgtaactatgatgactcttctacttccgggaataggtgtaacttataacggt
gaagaaatcggaatggaagatacatggatctcatgggaagacaccaaagatccgcaaggt
tgcaatgctggcaaagagggttatgagaaagcatcccgagatcccgctagaaccccattc
caatgggataatactacttcggctggattctctacaaacccgaagacatggctgccagtt
aataaaaattatctgacacttaatttagccgcacaaaaggaaggcaatacccacaactct
tactataagttatatataagaacgtctgatttacgaaaaaagccggcatttaaatttgga
tctttgaccacgagattattgaacaataatgttctctctcttactaggagattttctaat
agtacatttacacaagtaatttatgtagcagtaaactttgcagataaagaagaaactgtt
gatttatcaatgcttgatgatgaaccaaatgaattaaatgtttattatgctagttcaaat
agccaacatctcattggaaatatcgatgatattcatgccttgaaaattcccgcatcaggc
agtgtaatatgtacaaatataaatacagataaaaccaggtaa

DBGET integrated database retrieval system