KEGG   Pogonomyrmex barbatus (red harvester ant): 105432637Help
Entry
105432637         CDS       T04903                                 

Definition
(RefSeq) peroxisomal multifunctional enzyme type 2-like isoform X1
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar01040  Biosynthesis of unsaturated fatty acids
pbar01100  Metabolic pathways
pbar01212  Fatty acid metabolism
pbar04146  Peroxisome
Module
pbar_M00861  beta-Oxidation, peroxisome, VLCFA
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    105432637
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    105432637
Enzymes [BR:pbar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     105432637
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     105432637
    4.2.1.119  enoyl-CoA hydratase 2
     105432637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MaoC_dehydratas MaoC_dehydrat_N
Motif
Other DBs
NCBI-GeneID: 105432637
NCBI-ProteinID: XP_011645841
LinkDB All DBs
Position
Unknown
AA seq 368 aa AA seqDB search
MFEYIGHLVRSSGCILRQNLSADVTPENVQKNWLKIIDMTSAKHLNSIQEATGELLGVVE
TMRSGISSNEVDYVVKNNYNFRDTILYALGVGATTQDPTDIRYLYENSDEFAVLPTFYVL
YGPMGCMNSSIVQDAIPFTQINPTRILHGEQYLEVYKQLPTEATVETRFKIQDVLDKGKG
AVVLIQHDTYNVANEEKLSSGQMSIFVIGAGGFKGKRTSTHTISTVDPPARNPDVTVTQK
TNIDQAALYRLSGDLNPLHLDPNVAMMAGFERPILQGLCSLGFSTRHVLQTYAAGDPYLF
KSIKVRFAKPVLPGQTLRTDMWRNNANRIYFQTSLVETDVSVITDDHYPHRKNKPEELES
MSLQEFAQ
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaatatataggtcatttagtgcgctcttcaggttgcattttgcggcaaaattta
tctgccgatgttacaccagaaaatgtgcaaaaaaattggttgaaaataattgatatgaca
tcagcgaagcatcttaattcaattcaggaagcaacaggagaattattaggtgttgtcgaa
actatgagaagtggtatttcgtcaaatgaagtagactatgtcgtgaagaataattataat
tttcgcgatactatactatatgcgcttggagttggagctacaactcaagatccaactgat
attcgttatttgtatgaaaattctgacgagtttgccgttttacctactttctatgttttg
tatggacctatgggatgtatgaactcatctattgtgcaagacgctattccatttacacaa
attaatccaacacggatacttcatggtgagcaatatctggaagtttataaacaactgcct
acagaagctacggtggagacgcgctttaaaattcaagatgttttggataaaggaaaaggc
gccgttgtcttaattcaacatgatacttacaatgtagcaaatgaagagaagttgtcaagt
gggcaaatgtctatatttgttatcggtgcaggtggtttcaaaggaaaacgaacatcaacg
cacactatttcaaccgttgatcctcccgctcgaaatccagatgtaacggttacacaaaag
actaatatcgatcaggctgctctatacagattaagcggagatcttaatcctttgcacctt
gaccctaatgtcgctatgatggcagggtttgaaagaccaatattgcaaggactatgctct
ctaggattttccacccgtcatgttcttcaaacttatgctgctggagatccatatttattc
aaatctatcaaggtgagatttgcaaagccggttctaccaggtcagactttgcgtactgat
atgtggcgcaacaacgctaacagaatatatttccaaacatctctcgtcgagactgacgta
tcggtcattacagatgatcattatccacatcggaagaataaaccggaagaattagaatcg
atgtctttacaggaatttgcacagtga

DBGET integrated database retrieval system