KEGG   Pogonomyrmex barbatus (red harvester ant): 105432788
Entry
105432788         CDS       T04903                                 

Definition
(RefSeq) uncharacterized protein LOC105432788
  KO
K16679  wengen
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar04013  MAPK signaling pathway - fly
pbar04214  Apoptosis - fly
pbar04215  Apoptosis - multiple species
pbar04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:pbar00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    105432788
   04391 Hippo signaling pathway - fly
    105432788
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    105432788
   04215 Apoptosis - multiple species
    105432788
SSDB
Motif
Pfam: Trp_oprn_chp TNFR_c6 CD225
Other DBs
NCBI-GeneID: 105432788
NCBI-ProteinID: XP_011646047
UniProt: A0A6I9WS52
LinkDB
Position
Unknown
AA seq 339 aa
MPRESCPGLLLTLVSVFVGLCESSAAGGAATSGAQQPQPQPQQQPQPQQQHPVCKPGLEF
WSAERASCWPCTRCAPDFTLSPCAIHKDATCGPLSALELDWSFLSSARKKPSQADGNDGT
VTPNMFLRLPEERTKERPFMEAGNLVDFGRESDGSLDDEEPVSASQESKTTHDPRERRKS
DEDNLPWDWQTAALVLAVCACIVFFLVAGCSALVYARQWRRMKRNFEPAGLEEISARLNL
MVKAELAELVAGAPMNPGDPETRCQYLEKLLDRKRETPVVATAAAAAAATAAAGWPEAAA
GNLYIEEGGTTTPRSKRSQIARIQHNIETILNHKSQGAD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgccgagggaatcttgtcccgggttgctgttgaccctggtgtcggtattcgtcggcctg
tgcgagtcctccgccgccggcggggccgcgacatccggcgctcagcagccacagccgcag
ccgcaacagcagccgcagccgcagcagcaacatccggtttgcaagcccggcttggaattc
tggtccgccgaacgcgcctcgtgctggccgtgcacccgatgcgcccccgacttcaccctg
agcccctgtgcgattcacaaggatgcgacctgcggcccgctgtcagcgcttgagctcgac
tggtcctttctgtcgtccgccagaaagaagccctcgcaagctgacggtaacgatgggacc
gtcactccgaacatgtttttacggctacccgaggaaaggacgaaggaacggcctttcatg
gaagccggcaatctcgtcgacttcggtcgcgagagcgacggaagcttggacgacgaggag
ccggtctccgcctcgcaggaatcaaaaacgacacacgatcctcgggagaggagaaaatcg
gacgaggacaacctaccgtgggactggcagaccgctgctctggtcctcgcggtatgcgcc
tgcatagtattcttcctggtagcaggatgctcggctctcgtctacgcgaggcaatggcgg
cgaatgaagaggaatttcgagccagcgggtctcgaagagatttcggccagattgaatctt
atggtgaaggcggagctggccgaattggtcgcaggggcaccgatgaatccaggtgatccc
gagaccagatgtcagtatctcgagaagcttttagaccggaaacgggagactccggtggtg
gcgacggcggcggcagcggcggcggcgacggcggcggctggctggccggaggcggcggcc
ggcaacttgtacatcgaggaggggggcacgacgacgccgaggagtaagcgatcgcagatc
gcgcggattcagcataacatcgagaccatcctcaatcacaagagtcagggcgccgattga

DBGET integrated database retrieval system