KEGG   Pogonomyrmex barbatus (red harvester ant): 105433171Help
Entry
105433171         CDS       T04903                                 

Definition
(RefSeq) cysteine sulfinic acid decarboxylase
  KO
K01594  sulfinoalanine decarboxylase [EC:4.1.1.29]
Organism
pbar  Pogonomyrmex barbatus (red harvester ant)
Pathway
pbar00430  Taurine and hypotaurine metabolism
pbar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pbar00001]
 Metabolism
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    105433171
Enzymes [BR:pbar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.29  sulfinoalanine decarboxylase
     105433171
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 105433171
NCBI-ProteinID: XP_011646635
LinkDB All DBs
Position
Unknown
AA seq 533 aa AA seqDB search
MFSTTDSLTKTDSLVVSRNGRGPTSESMDGSVSVLFAMAASSTNGIPTSSVVELLEKFLK
ILKEERVFDQSNDQPVVRFCYPSSLMKQISISLEDEPANHEEIETAIRQTIHYSVKTSSP
HFHNQLYAGIDEFGLIGSWLTDVLNTSQYTYEVAPVFTLMEREVMQKSLELFGYPSMPNA
DGIMCPGGSISNMYGMVLARHKKIPQVKKSGLCSLNLPLACFTSEDSHYSILKAANWLGI
GTDHVYKVKTDEFGRMKVDDLKRLLIKARNDGTLPFFVNATAGTTVLGAIDPLPEIAAIC
RNESLWLHVDACLGGTLLLSDKYRPRLRGIELSDSVSWNPHKMLGAPFQCSLFLVKGKNI
LHEVNSAKAGYLFQQDKFYDVSWDTGDKSVQCGRKVDAMKFWLMWKARGKIGLARSVERA
MFCAEYFLKRIKETAGFRLVQPRYHCCNICFWYVPPTMRNQKETPAWWEKLYQVTIEIKK
RMNMNGSLMIGYTPLPQKELGNFFRMVVNCQPPPTKSSMDYVVRQIEKYAADL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaacgactgattcgttgacaaagaccgattcgctagtggtaagtcgaaatgga
aggggcccaacaagcgagtcgatggatgggtcggtcagtgtactcttcgcgatggctgca
tcaagtaccaacggtataccaacatcaagtgtcgtcgagctgttggagaagttcctgaag
attctcaaagaggagcgtgtgtttgaccaatccaatgatcagcctgttgtacgattctgt
tatccctcatctttaatgaaacagatatcaatctctttggaagatgagccagcaaatcat
gaagagatcgaaacagcgatacgacagactatacattattccgtgaaaacgtccagtccg
cattttcacaatcaactttacgctggaattgacgaatttggattaattggttcctggttg
acggacgtattaaacactagccagtatacttacgaagtcgcgcccgtatttaccttgatg
gagcgagaagtgatgcagaagtcgctggagctgtttggctatccgtcgatgccaaatgct
gacggtataatgtgtccaggaggtagcatatcgaatatgtacgggatggtgttggccaga
cataagaagataccgcaagtgaaaaaatcggggctctgttccctaaacctacccctagcg
tgttttaccagcgaagacagtcattactcaattctaaaagctgccaattggttgggcatt
ggcactgaccatgtgtacaaggtgaaaacggacgagtttggtcgcatgaaagtggatgat
ctgaagagactcttaataaaggcgaggaacgacgggaccctgccattcttcgtaaatgct
accgccggaactacggtgctcggtgctatcgatccattaccggaaattgccgcgatatgt
cggaacgagtcactttggctgcacgtagacgcttgtctgggtggtaccttgttattatcg
gataagtaccggccgaggctgcgaggcatcgaattatcagattcagtgtcttggaatccg
cacaaaatgcttggagcgccgtttcaatgttccttgttcctggttaaaggtaagaatatc
ctacacgaggtgaatagcgccaaagcgggatatcttttccaacaggacaaattctatgat
gttagctgggacacaggtgataaaagcgtgcaatgcggcaggaaggtggacgcaatgaaa
ttttggttaatgtggaaagcccgcggtaagatcggccttgcacgatcggtggaacgagcg
atgttctgcgcggaatactttttgaagcgaattaaagagactgccggttttcgattggtg
cagcctcgctatcactgttgcaatatttgcttttggtatgtgccaccgacaatgcgtaat
cagaaagaaactccagcttggtgggagaaactgtatcaggtcacaattgagataaagaaa
cgcatgaatatgaacggatctctgatgattggttatacacccttacctcagaaagaactt
ggcaatttctttcgcatggtcgtgaactgccaaccacctcccacaaaatcgtccatggat
tacgttgtcaggcagattgaaaaatatgcggctgatttgtag

DBGET integrated database retrieval system