KEGG   Phycisphaerae bacterium SM-Chi-D1: SMSP2_00644Help
Entry
SMSP2_00644       CDS       T04749                                 

Gene name
pknB
Definition
(GenBank) Serine/threonine-protein kinase PknB
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pbas  Phycisphaerae bacterium SM-Chi-D1
Brite
KEGG Orthology (KO) [BR:pbas00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pbas01001]
    SMSP2_00644 (pknB)
Enzymes [BR:pbas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     SMSP2_00644 (pknB)
Protein kinases [BR:pbas01001]
 Serine/threonine kinases: Other
  Bacterial family
   SMSP2_00644 (pknB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kinase-like Pkinase_fungal Haspin_kinase Kdo Seadorna_VP7 PIP49_C RIO1 FTA2 KIND
Motif
Other DBs
NCBI-ProteinID: AQQ70300
UniProt: A0A1Q2MCB5
LinkDB All DBs
Position
824157..825386
Genome map
AA seq 409 aa AA seqDB search
MAGSTDTIFGRLALERSFCSEVELKDCRAALKEISSDKRPALASVMVKKGYITKSQAARL
LDEIKKQQETQGQIPGYDIIEKIGSGAMAIVYKAKQKSLDRTVAIKVLPHKFAAKDNYVD
RFYKEGQLAAKLNHNNIVQAIDVGQASGLYYFVMEYVEGKSIYDDLSAGKVFSEQEALEI
ILQLARALEHAHAQGLIHRDIKPKNIMITKDGTVKLADLGLARTTSDVEAAENEKGKAFG
TPFYIAPEQIRGDVNIDGRADVYGLGATFYHMVTGQVPFNAPNPKEVMKKHLKEPLTPPD
HINVTLSAGVAIIIETMMAKDPNERYQNPSDLVKDLEAVSKGNSPVFAAKRVDIDTLSEL
ESGSPVVIEGDTRMYPENVITRYRIICAVLSAVILLLILLMVFGKGGTQ
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggccggaagtacagatacgatttttggaaggcttgcgcttgagcggagtttttgttca
gaagtagagcttaaagactgccgcgctgcgcttaaggaaatttccagtgataaaaggccc
gctttggccagtgttatggtcaaaaaaggatatataacaaaatctcaggccgcacgattg
cttgatgagataaaaaaacagcaggaaactcaagggcagatccccggttacgacataata
gaaaaaatcggctctggtgctatggctatagtctataaggccaagcagaaaagccttgac
agaacggttgccataaaagtcctgccgcacaaattcgccgccaaggacaattatgttgac
cgtttctataaagaaggccagcttgccgccaagctcaaccacaacaatatcgttcaggcg
atagatgtaggccaggccagtggtctttattactttgtcatggaatatgttgagggtaaa
tccatctatgatgacctttcagccggcaaggtgttctctgaacaggaggctctcgagatt
atcctccagcttgcaagggctcttgagcacgcccatgcccaggggctgattcaccgtgat
ataaaacccaaaaatataatgataaccaaggacggcacagtaaaactggcagatcttggt
ctggccaggacaacttcagatgtagaggctgccgaaaatgaaaagggaaaagcctttggc
acaccgttctatattgcccctgagcagatacgcggagacgttaatatagacggcagggcg
gacgtatatgggcttggagcaactttttatcatatggttaccggccaggttccgtttaac
gcgcccaaccctaaagaagtgatgaaaaaacatctcaaagagcccttaacccctcctgac
catataaacgtaactctttctgccggggttgctatcattatagagacaatgatggcaaaa
gatcctaatgaaaggtaccagaacccatctgatttggttaaagaccttgaggccgtttca
aaaggaaattcgcctgtatttgccgcaaagagggttgatattgataccctctcagagctt
gaaagcggatctccggtggtaattgagggcgatacacggatgtatccggaaaacgttatc
acaagatacaggattatttgcgctgttttgagtgccgttattctgcttcttattctgctg
atggtttttggtaaaggcggcacgcagtaa

DBGET integrated database retrieval system