KEGG   Phycisphaerae bacterium SM-Chi-D1: SMSP2_01128Help
Entry
SMSP2_01128       CDS       T04749                                 

Gene name
aroK
Definition
(GenBank) Shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
pbas  Phycisphaerae bacterium SM-Chi-D1
Pathway
pbas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pbas01100  Metabolic pathways
pbas01110  Biosynthesis of secondary metabolites
pbas01130  Biosynthesis of antibiotics
pbas01230  Biosynthesis of amino acids
Module
pbas_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:pbas00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SMSP2_01128 (aroK)
Enzymes [BR:pbas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     SMSP2_01128 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Thymidylate_kin CbiA
Motif
Other DBs
NCBI-ProteinID: AQQ70767
UniProt: A0A1Q2MEP3
LinkDB All DBs
Position
complement(1453342..1453824)
Genome map
AA seq 160 aa AA seqDB search
MGVGKTAVGTELAKLTDRELVDLDSIIEDRSGTDIPSVFREHGEDYFRRLESSLMEDYLT
SGRGVILSCGGGIVISERNRQLLAKHAEVVWLEQDIDVCLERVQSGSRPLLDREDSSDFA
RELYEKRKPLYKQAADVVINRSDKDIETTAREIYDMLKNS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcggcaagaccgccgttggtactgagctggcaaagctgaccgaccgcgagctg
gtagatctggacagcatcattgaagaccgcagcgggacggatattccctctgtcttccgc
gagcacggtgaggattattttcgccggcttgaatcgtcgctgatggaggattatcttacc
agcggcaggggtgtcatactctcgtgcggcggcggtatagttatttcagagcgtaaccgg
caattacttgcaaagcacgctgaagtcgtctggctcgaacaggatatcgacgtttgtctt
gagagggtacagagcggcagcaggccgctgcttgaccgcgaggattcgtctgattttgcc
agagagctgtatgagaaacgcaaacctctgtacaaacaggcggcggatgttgtaattaac
agaagtgacaaagatattgagacaacagcccgggaaatatatgatatgcttaaaaacagc
taa

DBGET integrated database retrieval system