KEGG   Phycisphaerae bacterium SM-Chi-D1: SMSP2_02363Help
Entry
SMSP2_02363       CDS       T04749                                 

Gene name
accC
Definition
(GenBank) Biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
pbas  Phycisphaerae bacterium SM-Chi-D1
Pathway
pbas00061  Fatty acid biosynthesis
pbas00620  Pyruvate metabolism
pbas00640  Propanoate metabolism
pbas01100  Metabolic pathways
pbas01110  Biosynthesis of secondary metabolites
pbas01120  Microbial metabolism in diverse environments
pbas01130  Biosynthesis of antibiotics
pbas01200  Carbon metabolism
pbas01212  Fatty acid metabolism
Module
pbas_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:pbas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SMSP2_02363 (accC)
   00640 Propanoate metabolism
    SMSP2_02363 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SMSP2_02363 (accC)
Enzymes [BR:pbas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SMSP2_02363 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SMSP2_02363 (accC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AQQ71984
UniProt: A0A1Q2MH57
LinkDB All DBs
Position
complement(3033064..3034416)
Genome map
AA seq 450 aa AA seqDB search
MFSKILIANRGEVALRIIRACHEMGIEAVVVYSTADKDSNYVRFADKAICIGPASPAQSY
LNINAIISAAEIADVDAIHPGYGFLAENAHFAEVCRECNIAFIGPSPEAMTKLGDKAKAR
DMAVDAKVPVVPGSPGPLSDEESGRKLAREIGFPVMIKASAGGGGRGMRLVHNDISFRNA
YQSAKAEAMGAFGNDEVYLEKFIENPRHVEVQVMSDKYGNVLHFYERDCSIQRRHQKLIE
EAPCPVLDEETREKLCEAAKRLMKNAKYENAATVEFLLDKDRNFYFIEANTRIQVEHPVS
ELVTGHDLIKMQIRVAAGEELKLKQKDIKLNGCAIECRINAENPDMNFSPSPGPVDEFFV
PGGFGVRVETFIKQGSYISPNYDSMIAKLLVHNNTRQEAIATMKRALNEFKIGPIKSTIP
ASLKILNDSDYVNNNVDTGYVERKIYPPKS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgttttcaaagatattgatagcaaaccggggcgaggttgccctgcgaataatacgagcc
tgccacgagatgggtatcgaggcggtagtggtgtattccaccgccgacaaagactcaaat
tatgtgcgttttgccgacaaggcaatctgcatcggcccggcctcaccggctcagagctac
ctgaacataaacgcgataatcagcgccgcggagatcgccgacgttgacgcgatacacccg
ggctacggatttctcgctgaaaacgcccatttcgcggaggtttgccgcgagtgcaacata
gcttttataggcccctcgcccgaggcaatgacgaaactcggcgacaaagccaaggcccgc
gatatggcggtagatgcaaaggttcccgtggttcccggctcgccgggaccgctgagcgat
gaggaatccggccgcaagctcgcccgtgaaatcggttttccggtaatgataaaggcatct
gccggcggcggcggacgcggcatgaggcttgtgcataacgatatcagtttccgcaacgcg
tatcagtcggccaaggccgaggcgatgggagcgttcggcaatgatgaggtatatctggag
aaattcatcgaaaacccgcggcatgtcgaagtgcaggtcatgagcgataagtacggcaac
gtgctgcacttctatgagcgtgactgctcaattcagcgccgccaccagaagctcatcgaa
gaggcgccctgtccggttcttgacgaggaaacccgcgagaagctctgcgaagcggcaaag
cggctgatgaaaaacgcaaaatacgaaaacgccgcgactgtggaatttctactcgataag
gacaggaatttctacttcatcgaggccaacacccgtatccaggttgagcatccggtcagc
gagctggttaccggccatgatttgataaagatgcagatacgtgttgccgccggcgaagag
ctcaagctcaaacaaaaagatatcaagctcaacggctgcgcgatagagtgcaggatcaac
gcggaaaatcccgatatgaatttttccccgagccccgggccggtggacgaatttttcgtg
ccgggcggtttcggtgttcgtgtggagactttcatcaaacagggcagctatatttcgccc
aattacgactcgatgatcgccaaactgctggtgcacaacaacacccgtcaggaggcaatc
gctacgatgaaacgcgcacttaatgagttcaaaatcggcccgataaagagtacaattccg
gcatcgctcaagatactcaatgacagcgattatgtgaacaacaacgtcgataccggctat
gttgagcggaaaatctatcccccaaagtcataa

DBGET integrated database retrieval system