KEGG   Oblitimonas alkaliphila: AKN87_03240Help
Entry
AKN87_03240       CDS       T04152                                 

Definition
(GenBank) 3-hydroxydecanoyl-ACP dehydratase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
pbb  Oblitimonas alkaliphila
Pathway
pbb00061  Fatty acid biosynthesis
pbb01100  Metabolic pathways
pbb01212  Fatty acid metabolism
Module
pbb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:pbb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    AKN87_03240
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:pbb01004]
    AKN87_03240
Enzymes [BR:pbb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     AKN87_03240
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     AKN87_03240
Lipid biosynthesis proteins [BR:pbb01004]
 Fatty acid synthase
  Component type
   AKN87_03240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AKX44221
UniProt: A0A0K1XBD1
LinkDB All DBs
Position
674885..675400
Genome map
AA seq 171 aa AA seqDB search
MTKQNAFTYEELLQCSRGELFGAGNAQLPAPNMLMMDRIVHISETGGKYGKGEIIAELDI
TPDLWFFDCHFKGDPVMPGCLGLDAMWQLVGFFLGWLGNPGRGRALGSKEVKFFGQVLPT
AKKLTYKIDIKRTINSSLILAIADGSVSVDGREIYSADGLRVGLFTSTDNF
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaaaacgcctttacctacgaagaattgctgcagtgcagccgtggagagctc
ttcggagcaggtaatgcgcaattgcccgcacccaacatgctgatgatggatcgtatcgtg
catatcagtgaaactggcggtaaatacggtaaaggagaaatcattgccgaactggatatt
acccctgacctgtggttttttgattgccactttaaaggtgatccagtcatgccaggttgc
cttggactcgatgccatgtggcaattagttggcttctttttaggctggttaggtaatcct
ggccgtggccgagcgttaggctcgaaagaggtcaagtttttcggccaagtactgccaacg
gcaaaaaagcttacctataaaatcgatatcaaacgcaccattaatagctcacttattcta
gccattgctgatggctcagtgagcgttgatggccgtgaaatttacagtgccgacggttta
cgcgttggtttatttacctctaccgataacttctaa

DBGET integrated database retrieval system