KEGG   Oblitimonas alkaliphila: AKN87_10320Help
Entry
AKN87_10320       CDS       T04152                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pbb  Oblitimonas alkaliphila
Brite
KEGG Orthology (KO) [BR:pbb00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AKN87_10320
Enzymes [BR:pbb01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AKN87_10320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored AlaDh_PNT_C Glutaredoxin FAD_binding_3 Thi4 K_oxygenase NAD_binding_8 HTH_43
Motif
Other DBs
NCBI-ProteinID: AKX45440
LinkDB All DBs
Position
2132362..2133915
Genome map
AA seq 517 aa AA seqDB search
MLDANLKTQLKAYLEKVTQPFEIVASLDEGAKSAELKSLLEEIASLSDKITLRLDGQDAR
KPSFNLNRINGDISLTFAGIPMGHEFTSLVLALLQVGGHPSKLAQDVIEQIKNLDTEMQF
ETYFSLSCQNCPDVVQALNLMAVLNPKIKHVAIDGALFQEEVEQRQVMSVPMIFLNGEMF
GQGRMGVEEILAKVDTGAVAREAEKISQKEAFDVLVVGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMSIENFISVQETEGPKLARAMEEHVRQYEVDIMNLQRATRLVPAAEKGG
LHTLEFESGAQLQAKSVILSTGARWREMNVPGEQEYRTRGVAYCPHCDGPLYKGKRVAVI
GGGNSGVEAAIDLAGIVSEVTLIEFDTKLRADEVLQKKLATLPNVTVIKNALTTEVKGDG
SKVTALVYKDRATEELHNIELEGIFVQIGLLPNSEWLKDTVELTNRGEIVVNDRAETSIP
GVFAAGDVTTVPYKQIVIAVGQGATASLSAFDYLIRS
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgctaatttaaaaactcaattaaaggcctacctagagaaggtgacgcagccc
ttcgagatcgttgcgtcccttgatgaaggtgccaagtctgctgaactaaaaagcttgctt
gaggaaatcgcgagcttaagtgacaaaattactctgcgtttagatgggcaggatgcgcgt
aagccatcgtttaacttaaatcgcattaatggcgatatcagcttaacgtttgctggtatt
cctatgggccatgaattcacttctttggttctggcgctgttacaagtgggcggtcatccc
tctaagttggcgcaagatgtgattgagcaaatcaaaaatttagacactgagatgcagttt
gaaacttacttctcattgtcctgccagaactgccctgatgtggtacaggcactgaactta
atggcggtgcttaacccaaaaattaagcatgtagcgattgatggggcattgttccaagaa
gaagtcgagcagcgtcaagtgatgtcggtgcctatgattttcctaaatggcgagatgttt
ggccaaggccgaatgggcgtcgaagaaattttagccaaagtagataccggtgccgtggcc
cgtgaagcggaaaaaatcagccaaaaagaagccttcgatgtattggtcgttggtggtggt
cctgctggtgctgctgcagcaatttacgctgcgcgtaaaggcattcgtaccggtgttgcg
gctgaacgctttggtggacaggtgctcgatacgatgtcgattgagaactttatctcagtt
caagaaactgagggaccaaagctggcgcgagcaatggaggaacatgtgcgtcagtacgaa
gtggatattatgaatctacagcgtgccacacgtttagttccagcggctgagaaaggtggc
ttgcacacccttgagtttgagtcgggcgctcagttacaggctaagtcagtgattttgtcc
acgggtgctcgctggcgcgaaatgaatgtgccgggtgagcaagagtatcgtacccgcggt
gtagcttactgcccgcactgtgacggtcctttgtataaagggaagcgtgttgcggtgatt
ggtggtggtaactcgggcgttgaagcggcgattgatttagcgggtattgtgtctgaggtg
acgctgatcgagtttgataccaaactgcgagcggatgaagtattgcagaaaaaactcgcc
accttgccaaacgtgactgtgattaaaaatgccctgaccacggaagtaaaaggtgatggc
agtaaagtgactgcgttggtttacaaagaccgtgcaactgaagagttacacaacattgag
ctagaaggtatcttcgtgcagattgggttgctgccaaatagtgagtggttgaaagatacc
gtagagctgaccaatcggggtgagattgtggtgaatgaccgtgctgaaaccagcattcct
ggggtatttgccgcaggtgacgtgactactgtaccttataagcagattgtgattgcagta
ggccaaggtgcaactgcttctttgagtgcttttgactacttgattcgctcgtaa

DBGET integrated database retrieval system